Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR329 IGR324 IGR325 IGR321 IGR322 IGR326 IGR327 IGR323 IGR328 MG436 MG432 pgm, - MG430 ptsI, - MG429 rpmB,rpL28, - MG426 pyrH, - MG434 MG427 MG428 rrf, - MG435 tsf, - MG433 deaD_2, - MG425 MG436 MG432 pgm, - MG430 ptsI, - MG429 rpmB,rpL28, - MG426 pyrH, - MG434 MG427 MG428 rrf, - MG435 tsf, - MG433 deaD_2, - MG425 Type: tandem, Name:  - 20 MG436 MG432 pgm, - MG430 ptsI, - MG429 tpiS,tim,tpiA, - MG431 tpiS,tim,tpiA, - MG431 pyrH, - MG434 MG427 MG428 rrf, - MG435 tsf, - MG433 deaD_2, - MG425 rpmB,rpL28, - MG426
* Calculated from Protein Sequence

Gene ID: MG430

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgm  

Definition:
phosphoglycerate mutase

Gene Start:
537563

Gene Stop:
536043

Gene Length:
1521

Molecular Weight*:
56857

pI*:
6.83

Net Charge*:
-1.41

EC:
5.4.2.1  

Functional Class:
Energy metabolism; Glycolysis and Gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis

Primary Evidence:
Hutchison III, C. A., S. N. Peterson, S. R. Gill, R. T. Cline, O. White, C. M. Fraser, H. O. Smith, J. C. Venter. 1999. Global transposon mutagenesis and a minimal mycoplasma genome. Science 286:2165-2169.

Comment:
This protein is a key enzyme of primary carbon metabolism. The catalytic activity of pgm is the following: 3-Phosphoglycerate to 2-Phosphoglycerate (reversible). By similarity it has been ascertained to have an absolute requirement for manganese (Mn). In B.subtilis this protein is found in an operon containing (in order: pgk, tpi, pgm and eno). See the following gene records for the remaining glycolytic enzymes: UU181 (tpi), UU184 (eno) and UU279 (pgk).

Reference:Comp Biochem Physiol B Biochem Mol Biol. 1995 Oct;112(2):287-93.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits
to phosphoglycerate mutase proteins; for example residues 1-503 are
71% similar to PMGI_MYCPN, phosphoglycerate mutase of Mycoplasma pneumoniae
(AE000021). Residues 3-504 are 44% similar to PMGI_BACSU, phosphoglycerate
mutase of Bacillus subtilis,(L29475).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0696 is e-gpcm-.
COG name: Phosphoglyceromutase/phosphopentomutase.
Functional Class: C
BeTs to e-g-cm-.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 5-445 and 446-503 constitute defined domains of PMGI_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in M. genitalium.

Pfam Summary:  Pfam Search
Residues 1 to 359 (E-value = 1.7e-224) place MG430 in the iPGM_N family which is described as BPG-independent PGAM N-terminus (iPGM_N) (PF06415)
Residues 367 to 482 (E-value = 2.3e-57) place MG430 in the Metalloenzyme family which is described as Metalloenzyme superfamily (PF01676)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
92  
147

PDB Hit:


Gene Protein Sequence:
MHKKVLLAILDGYGISNAIYGNAVQNANTPMLDELINSYPCVLLDASGEA
VGLPMGQIGNSEVGHLNIGAGRVVYTGLSLINQHIKDRSFFANKAFLKTI
EHVEKNHSKIHLIGLFSNGGVHSHNEHLLALIELFSKHAKVVLHLFGDGR
DVAPCSLKQDLEKLMIFLKNYPNVVIGTIGGRYYGMDRDQRWDREMIAYK
ALLGVSKNKFNDPIGYIETQYQNQITDEFIYPAINANLNSDQFALNNNDG
VISFNFRPDRARQMSHLIFNSNYYNYQPELKRKENLFFVTMMNYEGIVPS
EFAFPPQTIKNSLGEVIANNNLKQLRIAETEKYAHVTFFFDGGFEVNLSN
ETKTLIPSLKVATYDLAPEMSCKAITDALLEKLNNFDFTVLNFANPDMVG
HTGNYQACIKALEALDVQIKRIVDFCKANQITMFLTADHGNAEVMIDNNN
NPVTKHTINPVPFVCTDKNVNFNQTGILANIAPTILEYLNLSKPKEMTAK
SLLKNNN

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATAAAAAAGTTTTATTAGCAATCCTTGATGGTTATGGGATCTCAAA
TGCTATTTATGGTAATGCAGTACAAAATGCAAATACCCCAATGCTAGATG
AATTAATCAATTCATATCCTTGTGTACTTTTAGATGCATCTGGGGAAGCA
GTTGGATTGCCTATGGGTCAAATAGGTAACTCTGAGGTAGGTCATCTAAA
TATTGGGGCAGGTCGAGTTGTTTATACTGGACTTTCTTTGATTAATCAAC
ATATTAAGGATCGTAGTTTTTTTGCAAATAAAGCTTTTTTAAAAACCATA
GAACATGTAGAAAAAAACCATTCAAAAATCCATTTAATTGGGTTATTTTC
CAATGGAGGAGTGCATAGTCATAATGAACATCTATTAGCACTCATTGAAT
TGTTTTCAAAACATGCAAAGGTAGTATTACATTTATTTGGTGATGGTAGA
GATGTAGCACCTTGTAGCTTAAAACAAGATCTTGAGAAATTAATGATATT
TCTAAAAAACTATCCTAATGTTGTTATTGGAACTATTGGGGGAAGATACT
ATGGAATGGATCGTGATCAACGCTGGGATCGTGAAATGATTGCTTATAAA
GCTTTATTAGGAGTTTCAAAAAATAAATTCAATGACCCAATTGGTTATAT
TGAAACGCAATATCAGAACCAAATTACTGATGAATTTATTTATCCTGCAA
TTAATGCCAATTTAAATTCTGATCAGTTTGCATTAAACAATAATGATGGA
GTTATTTCCTTTAATTTTAGACCTGATAGAGCAAGACAAATGTCCCATTT
GATCTTTAACAGCAATTATTACAACTATCAACCTGAATTGAAACGAAAAG
AAAATTTATTTTTTGTAACAATGATGAATTATGAGGGAATTGTACCTAGC
GAATTTGCTTTTCCACCTCAAACCATTAAAAATAGTCTTGGTGAAGTAAT
TGCTAATAATAATTTGAAGCAATTGAGGATTGCAGAAACTGAAAAGTATG
CTCACGTTACTTTCTTTTTTGATGGTGGTTTTGAAGTTAATCTCAGCAAT
GAAACAAAGACATTAATTCCTTCTTTAAAAGTTGCTACATATGATTTAGC
TCCCGAAATGTCATGTAAAGCTATTACTGATGCACTACTAGAAAAGCTTA
ATAACTTTGATTTTACTGTTTTAAATTTTGCTAATCCTGATATGGTAGGT
CATACTGGTAACTATCAAGCTTGCATTAAAGCTCTTGAAGCACTCGATGT
TCAAATTAAACGAATAGTTGATTTTTGTAAAGCTAATCAAATAACTATGT
TTTTAACTGCAGATCATGGGAATGCAGAAGTGATGATTGATAATAATAAC
AATCCAGTTACTAAACACACTATTAATCCTGTACCATTTGTATGTACTGA
CAAAAATGTTAACTTTAATCAAACTGGAATTTTAGCTAATATTGCTCCTA
CTATCTTGGAATATCTTAACCTTAGCAAACCAAAAGAGATGACTGCAAAA
TCCTTATTAAAAAATAACAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy