Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR316 IGR313 IGR314 IGR311 IGR315 IGR317 IGR312 rpS9, - MG417 rpL13, - MG418 dnaX, - MG420 MG415 MG419 MG422 uvrA, - MG421 MG414 rpS9, - MG417 rpL13, - MG418 dnaX, - MG420 MG415 MG419 MG422 uvrA, - MG421 MG414 rpL13, - MG418 dnaX, - MG420 MG415 MG419 MG422 uvrA, - MG421 MG414 rpS9, - MG417
* Calculated from Protein Sequence

Gene ID: MG420

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaX  

Definition:
DNA polymerase III gamma and tau subunits

Gene Start:
524144

Gene Stop:
523365

Gene Length:
780

Molecular Weight*:
29757

pI*:
9.47

Net Charge*:
7.73

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
PolIII is a multichain enzyme with replicative function as well as 3' to 5' exonucleolytic
activity. For other polIII subunits, see MG001, 007, 031, 261. See
Kooonin and Bork, TIBS 21:128 (1996).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to polIII gamma chain sequences, e.g. residues 1-222
are 71% similar to DP3%_MYCPN. Residues 2-222 are 46% similar to DP3%_BACSU.
MG420 is similar to T.pallidum TP1005, a polIII gamma and tau subunit
sequence. A weaker similarity is noted to TP0521, also a polIII gamma/tau
sequence. Similarity also exists to CT334, a polIII gamma and tau sequence
from C.trachomatis, with weaker similarity to CT187.


COGS Summary:  COGS Search
The phylogenetic pattern of COG0470 is ehgpcmy.
COG name: ATPases and helicase subunits involved in DNA replication.
Functional Class: L
BeTs to -hg-cmy-.

Blocks Summary:  Blocks Search
Residues 39-54 are matched to block PR00819B, concerned with
CBXX/CFQX superfamily signature, e.g. BCSP5KGEN.
Residues 71-90, 37-62 are matched to blocks PR00193A,B,
concerned with myosin heavy chain signature, e.g. S45573.
Residues 33-55 are matched to block PR00228F, concerned with
geminivirus CLV AL1 coat protein signature, e.g. TYLCV124.

ProDom Summary:  Protein Domain Search
Residues 64-120, 121-170, 175-220 constitute defined domains
of DP3X_MYCGE. Residues 72-110, 44-63 support this assignment.
Residues 4-79 are 34% similar to a DNA polymerase accessory
protein 44 domain represented by DPA4_BPT4.

Paralogs:  Local Blast Search
MG420 is weakly paralogous to MG007, also a polIII subunit sequence: residues 72-176
are 29% similar to residues 37-142 of MG007.

Pfam Summary:  Pfam Search
Residues 39 to 233 (E-value = 1.8e-06) place MG420 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
54  
103
non-globular  
138  
221
transmembrane  
222  
245

PDB Hit:
gi|3212391|pdb|1A5T| Crystal Structure Of The Delta Prime Subunit Of The Clamp-Loader Complex Of Escherichia Coli Dna Polymerase Iii Zinc Finger, Dna Replication Mol_id: 1; Molecule: Delta Prime; Chain: Null; Synonym: Holb; Ec: 2.7.7.7; Engineered: Yes;

Gene Protein Sequence:
MHQVFYQKYRPINFKQTLGQESIRKILVNAINRDKLPNGYIFSGERGTGK
TTFAKIIAKAINCLNWDQIDVCNSCDVCKSINTNSAIDIVEIDAASKNGI
NDIRELVENVFNHPFTFKKKVYILDEAHMLTTQSWGGLLKTLEESPPYVL
FIFTTTEFNKIPLTILSRCQSFFFKKITSDLILERLNDIAKKEKIKIEKD
ALIKIADLSQGSLRDGLSLLDQLAISLIVKKLVLLMLKKHLISLIEMQNL
LLLKQFYQEI

Gene Nucleotide Sequence:  Sequence Viewer
ATGCACCAAGTTTTTTATCAAAAATATCGGCCAATCAATTTCAAACAAAC
CCTAGGACAAGAATCGATAAGAAAAATCTTGGTGAATGCTATTAACAGGG
ATAAACTACCTAATGGTTATATCTTTTCAGGTGAAAGAGGAACAGGTAAA
ACTACTTTTGCAAAGATAATAGCAAAAGCGATAAACTGCTTAAATTGAGA
TCAAATTGATGTTTGTAATAGTTGTGATGTGTGTAAAAGTATTAACACTA
ATAGTGCCATTGATATAGTTGAGATAGATGCAGCTTCTAAAAATGGTATT
AATGATATTAGAGAGTTGGTAGAAAATGTTTTCAATCATCCCTTCACATT
TAAAAAAAAGGTTTATATTTTAGATGAAGCACACATGTTAACCACCCAAT
CATGGGGTGGCTTGTTAAAAACTTTAGAAGAATCACCACCTTATGTTCTT
TTTATTTTTACAACTACTGAATTTAACAAGATTCCATTAACAATTTTGTC
CAGATGTCAAAGCTTCTTTTTTAAAAAAATAACTAGTGATTTAATCCTTG
AAAGATTAAATGATATAGCAAAAAAAGAAAAGATTAAGATAGAGAAAGAT
GCATTAATAAAAATTGCTGATTTATCCCAAGGTTCATTGCGTGATGGGCT
TAGCTTACTAGATCAATTAGCAATTTCTCTGATAGTGAAAAAATTAGTAT
TACTGATGTTGAAAAAACATTTAATATCGTTGATAGAAATGCAAAATTTA
CTTTTATTAAAGCAGTTTTATCAGGAGATA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy