Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR316 IGR313 IGR314 IGR311 IGR315 IGR312 rpS9, - MG417 rpL13, - MG418 dnaX, - MG420 MG415 MG419 uvrA, - MG421 MG414 rpS9, - MG417 rpL13, - MG418 dnaX, - MG420 MG415 MG419 uvrA, - MG421 MG414 rpL13, - MG418 dnaX, - MG420 MG415 MG419 uvrA, - MG421 MG413 MG414 rpS9, - MG417 MG413
* Calculated from Protein Sequence

Gene ID: MG417

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpS9  

Definition:
30S ribosomal protein S9

Gene Start:
521868

Gene Stop:
521473

Gene Length:
396

Molecular Weight*:
15131

pI*:
11.31

Net Charge*:
22.22

EC:
 

Functional Class:
Translation; Ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
See Prosite PDOC00311.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to 30S ribosomal protein S9 sequences, e.g.
residues 1-132 are 76% similar to RS6_MYCPN.
MG417 is similar to T.pallidum TP1024, a predicted
ribosomal protein S9 sequence. It is also similar to C.trachomatis
30S ribosomal protein S9 sequence CT126.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0103 is ehgpcmy.
COG name: Ribosomal protein S9.
Functional Class: J
BeTs to -hg-cmy-.

Blocks Summary:  Blocks Search
Residues 10-31, 12-33, 54-89, 106-132 are members of blocks
BL00360A,B,C(Ribosomal protein S9 proteins).
Residues 66-85 are matched to block PR00757A, concerned
with flavin-containing amine oxidase signature, e.g. S45812.

ProDom Summary:  Protein Domain Search
Residues 28-89, 90-124 constitute defined domains of RS9_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 10 to 132 (E-value = 1.3e-48) place MG417 in the Ribosomal_S9 family which is described as Ribosomal protein S9/S16 (PF00380)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
58  
132

PDB Hit:


Gene Protein Sequence:
MDKKSFYGLGRRKSSTAKVYLYQSKDKGKITINHRNPSDYFPNKLVIQDM
EQPLELTKLKDNFDINVVVKGGGFTGQAGAIRLGIVRALIKFNPDLKKLL
KTKKLTTRDKRAKERKKFGLYGARRAPQFTKR

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAAAAAATCTTTTTATGGACTTGGTCGTCGTAAATCTTCTACTGC
TAAAGTTTATTTATATCAAAGCAAAGATAAGGGTAAAATAACCATTAATC
ATCGTAATCCTAGCGATTATTTTCCAAATAAATTGGTGATTCAAGATATG
GAACAACCCTTAGAGTTAACCAAACTTAAGGATAACTTTGATATCAATGT
TGTTGTTAAAGGTGGAGGATTTACTGGGCAGGCAGGAGCCATTAGATTAG
GTATTGTTCGTGCTTTAATAAAATTTAATCCAGATCTTAAAAAGTTATTA
AAAACCAAAAAATTAACAACACGTGATAAGCGTGCTAAGGAACGCAAAAA
ATTTGGTTTATATGGTGCTAGACGTGCACCACAATTTACTAAGCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy