Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR309 IGR307 IGR308 IGR304 IGR303 IGR302 IGR306 IGR310 IGR305 atpE, - MG404 atpF, - MG403 MG409 atpB, - MG405 MG412 eno, - MG407 atpA, - MG401 pstA, - MG411 pmsR, - MG408 atpE, - MG404 atpF, - MG403 MG409 atpB, - MG405 MG412 eno, - MG407 atpA, - MG401 pstA, - MG411 pmsR, - MG408 atpE, - MG404 atpF, - MG403 MG409 atpB, - MG405 MG412 eno, - MG407 atpA, - MG401 pstA, - MG411 MG406 atpH, - MG402 pstB, - MG410 MG406 atpH, - MG402 pstB, - MG410 pmsR, - MG408
* Calculated from Protein Sequence

Gene ID: MG408

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:


Gene Name:
pmsR  

Definition:
peptide methionine sulfoxide reductase

Gene Start:
510903

Gene Stop:
511373

Gene Length:
471

Molecular Weight*:
18399

pI*:
6.53

Net Charge*:
-0.66

EC:
1.8.4.6  

Functional Class:
Regulatory functions  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to Peptide methionine sulfoxide reductase
and its related sequences, e.g. residues 1-157 are 66%
similar to PMSR_MYCPN. MG408 is similar to T.pallidum TP0633, a predicted
protein-methionine-S-oxide reductase sequence. It shows no
significant similarities to C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0225 is ehgpc-y.
COG name: Peptide methionine sulfoxide reductase.
Functional Class: O
BeTs to h,g,c,y.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 13-146 constitute a defined domain of PMSR_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 2 to 157 (E-value = 7.9e-102) place MG408 in the PMSR family which is described as Peptide methionine sulfoxide reductase (PF01625)

PDB Hit:


Gene Protein Sequence:
MKEIYFGGGCFWGIEKYFQLIKGVKKTSVGYLNSRIRNPSYEQVCSGYTN
AVEAVKVEYEEKEISLSELIEALFEVIDPTIRNRQGNDIGTQYRTGIYWT
DSSDEKIINDKFLKLQKNYSKPIVTENKKVENYYLAEEYHQDYLKKNPNG
YCHIKFD

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGAAATTTATTTTGGTGGTGGTTGTTTTTGAGGAATAGAAAAATA
TTTTCAACTTATTAAGGGTGTTAAAAAAACATCTGTTGGTTATCTCAACT
CTAGGATTAGAAATCCTAGTTATGAGCAGGTTTGTTCTGGTTATACTAAT
GCTGTTGAAGCTGTAAAAGTTGAATACGAAGAAAAAGAAATTTCTCTTTC
AGAATTAATTGAAGCACTTTTTGAAGTTATTGATCCAACTATAAGAAATA
GACAAGGTAATGATATTGGAACACAATATCGTACTGGTATTTATTGAACT
GATAGCAGTGATGAAAAAATAATTAATGATAAGTTCTTAAAACTTCAAAA
AAACTACAGTAAACCAATTGTTACAGAAAATAAAAAAGTAGAAAATTATT
ATCTTGCTGAAGAATACCATCAGGATTATTTAAAAAAGAATCCAAACGGT
TATTGCCACATCAAATTTGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy