Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR307 IGR301 IGR308 IGR304 IGR303 IGR302 IGR306 IGR305 IGR300 atpE, - MG404 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 pstA, - MG411 pmsR, - MG408 atpE, - MG404 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 pstA, - MG411 pmsR, - MG408 atpE, - MG404 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 pstA, - MG411 MG406 atpH, - MG402 pstB, - MG410 MG406 atpH, - MG402 pstB, - MG410 pmsR, - MG408
* Calculated from Protein Sequence

Gene ID: MG405

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpB  

Definition:
ATP synthase F0, subunit A (protein 6)

Gene Start:
509012

Gene Stop:
508137

Gene Length:
876

Molecular Weight*:
33162

pI*:
10.21

Net Charge*:
6.47

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
ATP6 is a key component of proton channeling. F-type ATPASES have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: ALPHA(3), BETA(3), GAMMA(1), DELTA(1), EPSILON(1). CF(0) has three main subunits: A, B AND C.

See MG398, atpE
See MG399, atpD
See MG400, atpG
See MG401, atpA
See MG402, atpH
See MG403, atpF
See MG404, atpE

See Prosite PDOC00420.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ATP synthase a subunit A sequences,
e.g. residues 1-292 are 63% similar to ATP6_MYCPN.
MG405 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0356 is ehgpc--.
COG name: ATP synthase B subunit.
Functional Class: C
BeTs to e,g,c.

Blocks Summary:  Blocks Search
Residues 99-126, 173-208, 114-149, 225-260, 244-266 are
members of blocks BL00449A,B,C (ATP synthase A subunit proteins).

ProDom Summary:  Protein Domain Search
Residues 1-125, 225-266, 141-176, 267-292 constitute defined
domains of ATP6_MYCGE. Residues 1-125 of ATP6_MYCGA
support this assignment.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 96 to 266 (E-value = 6.7e-29) place MG405 in the ATP-synt_A family which is described as ATP synthase A chain (PF00119)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
37  
59
transmembrane  
102  
119
transmembrane  
127  
151
transmembrane  
178  
203
transmembrane  
207  
227
transmembrane  
231  
260

PDB Hit:


Gene Protein Sequence:
MSPREIVLKETNQIDFISNQSIFDISPISGWKPFAPTDQILGIFIVFVLL
LTFFIFYKLKLKKADSLKNNSYFLLLFQMLFVWVQDTTADLLGEENKKFA
PYFLMLLLYIVSSNLVSLLGGISPPTSSLTFTFSLGLATFIGIVVMGIRY
QRWNFFKEFAFGITVKGKKYSTFIPNPFSILSGFAPLFSISLRLWGNILA
GTVILALFYNFWIFIFSSINNQPLALSLGTVFAGLITPVLHIYFDVIAGV
LQGYVFVMLTYNYWAKMRNQGLENNNASELHFKGIKVIQENI

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGCCACGGGAGATAGTTTTAAAAGAAACTAATCAAATAGATTTCAT
TTCCAATCAAAGTATTTTTGATATCTCACCAATTAGCGGTTGAAAACCAT
TTGCCCCTACTGATCAAATTCTTGGTATTTTTATTGTTTTTGTACTGCTT
CTAACTTTTTTTATTTTTTATAAGCTTAAGTTAAAAAAAGCAGATTCTTT
AAAAAATAATTCATATTTTTTGCTTTTATTTCAAATGTTGTTTGTTTGGG
TACAAGATACAACAGCAGATCTTTTAGGAGAGGAAAATAAGAAATTTGCT
CCCTACTTTTTAATGTTGCTTCTGTACATAGTATCAAGCAACTTAGTTAG
CTTGCTTGGTGGTATTTCACCACCAACATCATCTTTAACATTTACTTTTT
CTTTAGGACTTGCAACTTTTATTGGGATTGTTGTTATGGGGATTAGATAC
CAAAGATGAAATTTTTTTAAAGAGTTTGCCTTTGGAATTACTGTTAAAGG
AAAAAAGTATTCTACTTTCATTCCAAATCCTTTTAGTATATTGAGTGGAT
TTGCACCGCTTTTTTCTATTTCATTAAGGTTATGGGGAAACATATTAGCG
GGCACAGTTATTTTGGCGCTTTTTTATAACTTTTGAATTTTTATTTTTTC
AAGTATTAATAACCAACCATTAGCACTTAGCTTAGGAACAGTTTTTGCAG
GTTTAATAACCCCAGTATTACACATCTATTTTGATGTAATTGCAGGTGTA
TTGCAGGGTTATGTTTTTGTAATGTTGACTTATAATTATTGGGCTAAAAT
GCGCAATCAAGGTTTGGAAAATAATAATGCAAGTGAATTACACTTTAAAG
GCATAAAGGTAATTCAAGAAAATATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy