Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR307 IGR301 IGR308 IGR304 IGR303 IGR302 IGR306 IGR305 IGR300 atpE, - MG404 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 pstB, - MG410 atpD, - MG399 eno, - MG407 atpA, - MG401 pmsR, - MG408 atpE, - MG404 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 pstB, - MG410 atpD, - MG399 eno, - MG407 atpA, - MG401 pmsR, - MG408 atpE, - MG404 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 pstB, - MG410 atpD, - MG399 eno, - MG407 atpA, - MG401 MG406 atpH, - MG402 MG406 atpH, - MG402 pmsR, - MG408
* Calculated from Protein Sequence

Gene ID: MG404

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpE  

Definition:
ATP synthase F0, subunit C (lipid-binding protein)

Gene Start:
508131

Gene Stop:
507826

Gene Length:
306

Molecular Weight*:
10586

pI*:
4.99

Net Charge*:
-1.78

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
F-type ATPASES have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: ALPHA(3), BETA(3), GAMMA(1), DELTA(1), EPSILON(1). CF(0) has three main subunits: A, B AND C.

The CF(0) c subunit (also called protein 9, proteolipid, or subunit III) is a highly hydrophobic protein of about 8 Kd which has been implicated in the proton-conducting activity of ATPase.

See MG398, atpE
See MG399, atpD
See MG400, atpG
See MG401, atpA
See MG402, atpH
See MG403, atpF
See MG405, atpB

See Prosite PDOC00526.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ATP synthase C chain (lipid-binding protein)
(also called protein 9) protein sequences, e.g. residues 1-102
are 75% similar to ATPL_MYCPN. MG404 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0636 is ehgpcm-.
COG name: H+ ATP synthase E chain.
Functional Class: C
BeTs to h,g,c,m.

Blocks Summary:  Blocks Search
Residues 38-91 are members of block BL00605(ATP synthase c
subunit proteins).

ProDom Summary:  Protein Domain Search
Residues 58-95, 1-35 constitute defined domains of ATPL_MYCGE.
Residues 14-100, 31-98 support this assignment, e.g. ATPL_MYCPN,
ATPL_SULAC.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 31 to 99 (E-value = 1.3e-29) place MG404 in the ATP-synt_C family which is described as ATP synthase subunit C (PF00137)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
33  
53
transmembrane  
75  
102

PDB Hit:


Gene Protein Sequence:
MEHVNEILATVGVILQQTQTTQDVNASAKLGAYIGAGVTMIAGSTVGIGQ
GYIFGKAVEAIARNPEVEKQVFKLIFIGSAVSESTAIYGLLISFILIFVA
GA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACATGTTAATGAAATTTTAGCTACAGTTGGTGTTATATTACAACA
AACTCAAACTACCCAGGATGTTAACGCTAGTGCTAAGCTAGGTGCTTATA
TAGGTGCTGGTGTTACTATGATTGCAGGTTCAACTGTAGGGATTGGACAA
GGTTATATTTTTGGTAAAGCTGTTGAGGCAATAGCAAGAAATCCTGAAGT
TGAAAAACAGGTTTTTAAACTAATTTTCATTGGTTCTGCTGTTTCTGAAT
CTACAGCAATTTATGGACTTTTAATTTCCTTTATCTTAATTTTTGTAGCA
GGAGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy