Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR307 IGR301 IGR308 IGR303 IGR304 IGR299 IGR302 IGR306 IGR305 IGR300 atpE, - MG404 atpC, - MG398 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 pstB, - MG410 atpD, - MG399 eno, - MG407 atpA, - MG401 pmsR, - MG408 atpE, - MG404 atpC, - MG398 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 pstB, - MG410 atpD, - MG399 eno, - MG407 atpA, - MG401 pmsR, - MG408 atpE, - MG404 atpC, - MG398 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 pstB, - MG410 atpD, - MG399 eno, - MG407 atpA, - MG401 MG406 atpH, - MG402 MG406 atpH, - MG402 pmsR, - MG408
* Calculated from Protein Sequence

Gene ID: MG403

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpF  

Definition:
ATP synthase F1, subunit b

Gene Start:
507820

Gene Stop:
507197

Gene Length:
624

Molecular Weight*:
24587

pI*:
7.47

Net Charge*:
0.45

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
F-type ATPASES have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: ALPHA(3), BETA(3), GAMMA(1), DELTA(1), EPSILON(1). CF(0) has three main subunits: A, B AND C.

See MG398, atpE
See MG399, atpD
See MG400, atpG
See MG401, atpA
See MG402, atpH
See MG404, atpE
See MG405, atpB

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ATP synthase subunit b sequences,
e.g. residues 8-207 are 62% similar to ATPF_MYCPN.
MG403 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0711 is .
COG name: Proton ATP synthase subunit b.
Functional Class: C
No related COGs were found when search was performed.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 79-128, 140-176 constitute defined domains of ATPF_MYCGE.
Residues 80-127, 75-205 support this assignment, e.g. ATPF_MYCGA.
Residues 81-201 are 33% similar to a probable eukaryotic initiation
factor C17C9.O3 domain represented by YDF3_SCHPO.
Residues 71-208 are 26% similar to a dilute myosin heavy chain
, isoform I domain represented by MYSD_CHICK .
Residues 71-194 are 27% similar to a moesin protein domain
represented by MOES_HUMAN.
Residues 74-194 are 27% similar to a TOLA protein domain
represented by TOLA_HAEIN.
Residues 74-191 are 26% similar to a Plectin protein domain
represented by PLEC_RAT.
Residues 88-170 are 31% similar to a hypothetical protein MJ0223
domain represented by Y223_METJA.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 50 to 181 (E-value = 1.1e-40) place MG403 in the ATP-synt_B family which is described as ATP synthase B/B' CF(0) (PF00430)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
32
transmembrane  
45  
70
coil-coil  
74  
208

PDB Hit:


Gene Protein Sequence:
MVKAKKLVFKWSLLVFSFFTLSLFLVSCTENVREIKSSSVINELFPNFWV
FITHLLAFFILLTLMIFLFWKPTQRFLNNRKNLLEAQIKQANELEKQARN
LLEESNQRHEKALIVSKEIVDQANYEALQLKSEIEKTANRQANLMIFQAR
QEIEKERRSLKEQSIKESVELAMLAAQELILKKIDQKSDREFIDKFIRDL
EANETEDD

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTAAAGGCAAAAAAACTTGTCTTTAAATGAAGCTTATTAGTTTTTAG
CTTTTTTACACTCAGCTTATTTTTGGTTTCTTGTACTGAGAATGTTAGAG
AAATTAAGAGTAGTTCAGTAATAAATGAACTTTTTCCTAACTTTTGGGTA
TTTATTACTCATTTACTAGCATTTTTCATCTTACTAACACTGATGATTTT
CTTGTTTTGAAAACCAACTCAAAGGTTTTTAAATAACCGTAAAAATTTAC
TAGAAGCACAAATCAAACAAGCTAATGAATTAGAAAAACAAGCAAGAAAT
CTACTTGAAGAATCTAATCAAAGGCATGAAAAAGCACTAATAGTTTCTAA
AGAAATTGTTGATCAAGCTAACTATGAAGCTTTGCAATTAAAAAGTGAAA
TAGAAAAAACAGCAAATCGCCAAGCTAACTTAATGATTTTTCAAGCTCGT
CAGGAAATTGAAAAAGAAAGACGTTCTCTTAAAGAACAATCTATTAAAGA
GAGTGTGGAATTGGCTATGTTGGCTGCACAAGAACTAATTCTCAAGAAAA
TAGATCAAAAATCAGATAGAGAATTTATTGATAAGTTTATTAGAGATTTA
GAAGCTAACGAAACAGAAGATGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy