Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR307 IGR301 IGR298 IGR304 IGR303 IGR299 IGR302 IGR306 IGR305 IGR300 atpE, - MG404 atpC, - MG398 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 MG397 pmsR, - MG408 atpE, - MG404 atpC, - MG398 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 MG397 pmsR, - MG408 atpE, - MG404 atpF, - MG403 MG409 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 MG397 MG406 atpH, - MG402 MG406 atpH, - MG402 atpC, - MG398 pmsR, - MG408
* Calculated from Protein Sequence

Gene ID: MG402

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpH  

Definition:
ATP synthase F1, subunit delta

Gene Start:
507201

Gene Stop:
506674

Gene Length:
528

Molecular Weight*:
20858

pI*:
10.36

Net Charge*:
11.10

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
F-type ATPASES have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: ALPHA(3), BETA(3), GAMMA(1), DELTA(1), EPSILON(1). CF(0) has three main subunits: A, B AND C.

See MG398, atpE
See MG399, atpD
See MG400, atpG
See MG401, atpA
See MG403, atpF
See MG404, atpE
See MG405, atpB

See Prosite PDOC00327.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ATPase delta-subunit sequences,
e.g. residues 1-175 are 72% similar to ATPD_MYCPN.
MG402 shows no significant similarities to T.pallidum and
C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0712 is ehgpc-y.
COG name: Proton ATP synthase delta subunit.
Functional Class: C
BeTs to e,g.

Blocks Summary:  Blocks Search
Residues 3-15, 75-96, 29-50, 134-171 are members of blocks
BL00389A,B,C(ATP synthase delta (OSCP) subunit proteins).
Residues 34-47 are matched to blocks BL01147B, concerned with
SUA5/yciO/yrdC family proteins, e.g. Y02L_MYCLE.

ProDom Summary:  Protein Domain Search
Residues 1-38, 39-169 constitute defined domains of ATPD_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 4 to 175 (E-value = 2.5e-07) place MG402 in the OSCP family which is described as ATP synthase delta (OSCP) subunit (PF00213)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
71  
89

PDB Hit:


Gene Protein Sequence:
MINAQAFGTALFQLSEEQKQVKKIYEECHFFLKLMRNFKDGSLSFLLNSY
TLTKPDKIRLVDKLFKNHFCQVFVDFLKVIILKGYFTLVEQAIKYFFDNV
ESQKHIQFIKIITAFELSSKQLNKIIAIMEKRFKTKVVYKTEIDRSLISG
IRIESSSHLFEKNVRDELKRIMAHFI

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAATGCACAAGCATTTGGAACTGCACTTTTTCAATTAAGTGAAGA
GCAAAAACAAGTAAAGAAAATTTATGAAGAGTGCCATTTTTTTCTGAAAT
TAATGCGTAATTTTAAAGATGGTTCATTATCGTTCTTACTTAATTCTTAT
ACACTAACAAAACCAGATAAAATAAGACTTGTTGATAAGTTGTTTAAAAA
TCATTTTTGTCAAGTTTTTGTTGATTTTTTAAAAGTAATTATTTTAAAGG
GTTACTTTACTTTAGTTGAACAGGCAATTAAGTATTTTTTTGATAATGTT
GAAAGTCAAAAACACATTCAATTTATCAAAATAATTACTGCTTTTGAATT
AAGCTCAAAACAACTTAACAAAATTATTGCAATAATGGAAAAACGTTTTA
AAACAAAGGTTGTTTATAAAACTGAGATTGATCGCAGTTTAATTTCAGGA
ATTAGGATAGAATCAAGTTCCCATTTATTTGAAAAAAATGTGCGTGATGA
ATTAAAACGCATAATGGCCCATTTTATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy