Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR301 IGR298 IGR304 IGR303 IGR299 IGR302 IGR306 IGR305 IGR300 atpE, - MG404 atpC, - MG398 atpF, - MG403 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 MG397 atpE, - MG404 atpC, - MG398 atpF, - MG403 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 MG397 atpE, - MG404 atpC, - MG398 atpF, - MG403 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 MG397 MG406 atpH, - MG402 MG406 atpH, - MG402
* Calculated from Protein Sequence

Gene ID: MG401

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpA  

Definition:
ATP synthase F1, subunit alpha

Gene Start:
506655

Gene Stop:
505102

Gene Length:
1554

Molecular Weight*:
57206

pI*:
7.18

Net Charge*:
0.59

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
F-type ATPASES have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: ALPHA(3), BETA(3), GAMMA(1), DELTA(1), EPSILON(1). CF(0) has three main subunits: A, B AND C.

See MG398, atpE
See MG399, atpD
See MG400, atpG
See MG402, atpH
See MG403, atpF
See MG404, atpE
See MG405, atpB

References: J. Bacterio. June 1997;(179)3746-3755. and
Biochem. J. 1992;(285):881-888.

See Prosite PDOC00137.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ATP synthase alpha chain sequences,
e.g. residues 1-517 are 86% similar to ATPA_MYCPN.
MG401 is similar to T.pallidum TP0402, a flagellum-specific
ATP synthase, TP0528 and TP0427(V-type ATPase, subunit B),
TP0426 and TP0529(V-type ATPase, subunit A). It is also
similar to C.trachomatis CT669 and CT717(flagellar type ATPase),
CT307 and CT308(V-TYPE sodium ATP synthase subunit B and A),
CT491(transcription termination factor rho).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0056 is ehgpc-y.
COG name: ATP synthase alpha subunit.
Functional Class: C
BeTs to e,g,c,y.

Blocks Summary:  Blocks Search
Residues 91-116, 240-251, 259-303, 329-366 are members of blocks
BL00152A,B,C,D(ATP synthase alpha and beta subunits proteins).

ProDom Summary:  Protein Domain Search
Residues 150-199, 200-217, 221-397, 417-446, 447-467 constitute
defined domains of ATPA_MYCGE.

Paralogs:  Local Blast Search
MG401 is paralogously related to MG399(ATP synthase beta chain),
residues 109-423 are 23% similar to MG399.

Pfam Summary:  Pfam Search
Residues 24 to 92 (E-value = 3.8e-19) place MG401 in the ATP-synt_ab_N family which is described as ATP synthase alpha/beta family, beta-barrel domain (PF02874)
Residues 190 to 370 (E-value = 6.9e-102) place MG401 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)
Residues 376 to 483 (E-value = 3.4e-20) place MG401 in the ATP-synt_ab_C family which is described as ATP synthase alpha/beta chain, C terminal domain (PF00306)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
89

PDB Hit:
gi|2981976|pdb|1SKY|B Chain B, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Atp Synthase, F1fo Atp Synthase, F1-Atpase, Alpha3beta3 Subcomplex Of F1-Atpase, Hydrolase Mol_id: 1; Molecule:

Gene Protein Sequence:
MADKLNEYVALIKTEIKKYSKKIFNSEIGQVISVADGIAKVSGLENALLN
ELIQFENNIQGIVLNLEQNTVGIALFGDYSSLREGSTAKRTHSVMKTPVG
DVMLGRIVNALGEAIDGRGDIKATEYDQIEKIAPGVMKRKSVNQPLETGI
LTIDALFPIGKGQRELIVGDRQTGKTAIAIDTIINQKDKDVYCVYVAIGQ
KNSSVAQIVHQLEVNDSMKYTTVVCATASDSDSMVYLSPFTGITIAEYWL
KKGKDVLIVFDDLSKHAVAYRTLSLLLKRPPGREAFPGDVFYLHSRLLER
ACKLNDENGGGSITALPIIETQAGDISAYIPTNVISITDGQLFMVSSLFN
AGQRPAIQIGLSVSRVGSAAQTKAIKQQTGSLKLELAQYSELDSFSQFGS
DLDENTKKVLEHGKRVMEMIKQPNGKPYSQVHEALFLFAINKAFIKFIPV
DEIAKFKQRITEEFNGSHPLFKELSNKKEFTEDLESKTKTAFKMLVKRFI
STLTDYDITKFGSIEELN

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGATAAACTAAATGAATACGTAGCATTAATCAAAACTGAAATTAA
AAAGTATTCCAAAAAAATATTTAACAGTGAAATTGGTCAAGTCATTAGTG
TTGCTGATGGAATTGCCAAGGTTAGTGGACTTGAAAATGCTTTATTAAAT
GAGTTAATTCAATTTGAAAATAATATTCAAGGAATAGTATTAAACCTTGA
ACAAAATACAGTCGGAATAGCACTTTTTGGTGACTATTCTTCGTTACGAG
AAGGCAGTACCGCTAAAAGAACCCACAGTGTAATGAAAACTCCTGTTGGT
GATGTTATGCTTGGTAGAATCGTCAATGCACTTGGTGAAGCAATTGATGG
TAGAGGTGATATTAAAGCTACTGAATATGATCAAATAGAAAAAATTGCTC
CAGGTGTAATGAAAAGGAAAAGTGTTAACCAACCACTTGAAACTGGAATC
TTAACAATTGATGCTTTATTTCCTATAGGTAAAGGACAACGTGAATTAAT
TGTTGGTGATAGACAAACAGGTAAAACTGCTATTGCGATTGACACTATCA
TTAATCAAAAAGATAAAGATGTTTATTGTGTTTATGTAGCAATTGGTCAA
AAAAATTCATCAGTAGCACAAATTGTACACCAACTTGAAGTTAATGATTC
AATGAAATACACTACAGTGGTTTGTGCTACAGCTAGTGACTCTGATTCCA
TGGTTTATTTAAGTCCTTTTACAGGAATAACTATTGCTGAATATTGACTT
AAAAAAGGAAAGGATGTTTTGATTGTATTTGATGACCTTTCTAAGCATGC
TGTTGCTTACAGAACTCTTTCACTCTTGTTAAAAAGACCACCTGGTAGAG
AAGCTTTTCCAGGAGATGTTTTTTATTTACATTCAAGACTTTTGGAACGT
GCATGCAAGTTAAATGATGAAAATGGTGGTGGCTCAATTACAGCTTTACC
AATTATAGAAACTCAAGCTGGTGATATCTCTGCATATATTCCTACAAATG
TTATTTCAATTACTGATGGCCAACTGTTTATGGTTAGTAGTCTATTTAAC
GCTGGACAACGCCCTGCAATTCAAATTGGTTTATCAGTTTCAAGGGTTGG
TAGTGCAGCACAAACAAAAGCGATTAAACAGCAAACTGGCAGTTTAAAAC
TAGAACTTGCTCAGTATAGTGAACTTGATAGTTTTAGTCAATTTGGTAGT
GATCTTGATGAAAATACAAAAAAGGTTTTAGAGCATGGTAAAAGAGTAAT
GGAAATGATTAAACAACCAAATGGTAAACCTTACTCTCAAGTCCATGAAG
CATTATTTTTATTTGCTATTAACAAAGCTTTCATTAAGTTTATTCCAGTT
GATGAAATTGCTAAATTTAAACAAAGGATAACAGAAGAATTTAATGGTTC
CCATCCTCTGTTTAAAGAGTTATCTAACAAAAAAGAATTTACTGAGGATT
TAGAAAGTAAAACTAAAACCGCTTTTAAAATGCTTGTGAAACGTTTTATC
AGTACATTAACAGATTATGATATTACCAAATTTGGTAGTATTGAGGAACT
TAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy