Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR301 IGR297 IGR298 IGR304 IGR303 IGR299 IGR302 IGR305 IGR300 IGR296 atpE, - MG404 atpC, - MG398 rpiB,lacA, - MG396 atpF, - MG403 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 MG395 MG397 atpE, - MG404 atpC, - MG398 rpiB,lacA, - MG396 atpF, - MG403 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 MG395 MG397 atpE, - MG404 atpC, - MG398 rpiB,lacA, - MG396 atpF, - MG403 atpG, - MG400 atpB, - MG405 atpD, - MG399 eno, - MG407 atpA, - MG401 MG395 MG397 MG406 atpH, - MG402 atpH, - MG402 MG406
* Calculated from Protein Sequence

Gene ID: MG400

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpG  

Definition:
ATP synthase F1, subunit gamma

Gene Start:
505099

Gene Stop:
504263

Gene Length:
837

Molecular Weight*:
32408

pI*:
9.80

Net Charge*:
8.05

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
F-type ATPASES have 2 components, CF(1) - the catalytic core - and CF(0) - the membrane proton channel. CF(1) has five subunits: ALPHA(3), BETA(3), GAMMA(1), DELTA(1), EPSILON(1). CF(0) has three main subunits: A, B AND C.

See MG398, atpE
See MG399, atpD
See MG401, atpA
See MG402, atpH
See MG403, atpF
See MG404, atpE
See MG405, atpB

See Prosite PDOC00138.

References: J. Bacterio. June 1997;(179)3746-3755. and Biochem. J. 1992;(285):881-888.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ATP synthase gamma-subunit sequences,
e.g. residues 1-279 are 70% similar to ATPG_MYCPN.
MG400 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0224 is ehgpc-y.
COG name: ATP synthase gamma subunit.
Functional Class: C
BeTs to e,g,c,y.

Blocks Summary:  Blocks Search
Residues 4-35, 70-88, 158-183, 250-275, 40-65, 231-279 are
members of blocks BL00153A-D(ATP synthase gamma subunit proteins).

ProDom Summary:  Protein Domain Search
Residues 7-72, 75-170, 225-277 constitute defined domains
of ATPG_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 2 to 277 (E-value = 5.1e-57) place MG400 in the ATP-synt family which is described as ATP synthase (PF00231)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
167  
221
coil-coil  
234  
265

PDB Hit:
gi|1827815|pdb|1COW|G Chain G, Bovine Mitochondrial F1-Atpase Complexed With Aurovertin B Atp Phosphorylase, Hydrogen Ion Transport, Atp Synthase, F1f Atp Synthase, F1-Atpase Mol_id: 1; Molecule: Bovine Mitochondrial F1-Atpase; Chain: A, B, C, D, E, F, G;

Gene Protein Sequence:
MAFIQEIKRRMNTVKSTIKITNAMKMVSRAKFIKFKKQFQEISLFFNEFY
KAVGQVVVSLKEPKKKPDNQKTLWIMMSSSLGLCGQHNSNMNKLLKANFK
ADDKIFFLGRKNQSFWNKNSQYNPAVGFIDIQDRDINFDYCQTIFDQIMD
AFKEFKLDRICMVYTKFKNSLIQQSQLFQVFPFDVETFKTLNPVVTDQQL
DFEPDQATIINLITPQFFDVALYGGLVETKLCESASRQNAMEAATKNAKD
LLDKYTLQFNKLRQNSITEEIIEVIGGMN

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTTTTATACAAGAAATTAAGCGCAGAATGAATACAGTAAAATCCAC
CATTAAGATAACTAATGCAATGAAAATGGTGTCACGCGCTAAGTTTATTA
AGTTCAAAAAACAGTTTCAAGAAATTAGTTTGTTTTTTAATGAATTTTAT
AAAGCTGTTGGCCAAGTAGTTGTTTCTTTAAAAGAACCAAAAAAGAAACC
AGATAACCAAAAAACTTTATGGATAATGATGAGTTCTTCTTTAGGACTTT
GTGGACAGCATAATTCGAACATGAATAAGTTATTAAAAGCTAATTTTAAA
GCTGATGATAAAATCTTTTTTTTAGGTAGAAAAAACCAATCATTTTGAAA
TAAAAATAGTCAATATAATCCTGCTGTTGGATTTATTGATATCCAAGATC
GTGATATTAATTTTGATTATTGTCAAACGATATTTGATCAGATTATGGAT
GCATTTAAAGAGTTTAAACTTGATCGAATTTGTATGGTTTACACTAAATT
TAAAAACTCATTAATCCAACAATCTCAGCTCTTTCAAGTTTTTCCTTTCG
ATGTTGAAACTTTTAAAACTTTAAATCCGGTTGTAACTGATCAACAACTT
GATTTTGAGCCAGATCAAGCCACGATAATTAATTTAATTACTCCACAGTT
TTTTGATGTGGCTCTGTATGGTGGCCTTGTTGAAACTAAGTTATGTGAAT
CAGCTTCTAGACAAAATGCAATGGAAGCTGCTACAAAGAATGCTAAAGAT
TTACTTGATAAATACACTTTACAATTTAACAAGCTAAGACAAAACTCTAT
TACAGAAGAGATTATTGAAGTTATAGGAGGTATGAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy