Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR301 IGR297 IGR298 IGR304 IGR303 IGR299 IGR302 IGR300 IGR296 atpE, - MG404 atpC, - MG398 rpiB,lacA, - MG396 atpF, - MG403 atpG, - MG400 atpB, - MG405 atpD, - MG399 atpA, - MG401 MG395 MG397 atpE, - MG404 atpC, - MG398 rpiB,lacA, - MG396 atpF, - MG403 atpG, - MG400 atpB, - MG405 atpD, - MG399 atpA, - MG401 MG395 MG397 Type: inverted, Name:  - 57 Type: inverted, Name:  - 63 atpC, - MG398 rpiB,lacA, - MG396 atpF, - MG403 atpG, - MG400 atpB, - MG405 atpD, - MG399 atpA, - MG401 MG395 MG397 atpH, - MG402 atpH, - MG402 atpE, - MG404
* Calculated from Protein Sequence

Gene ID: MG399

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpD  

Definition:
ATP synthase F1, subunit beta

Gene Start:
503976

Gene Stop:
502831

Gene Length:
1146

Molecular Weight*:
42109

pI*:
5.73

Net Charge*:
-6.05

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
See MG398, atpE
See MG400, atpG
See MG401, atpA
See MG402, atpH
See MG403, atpF
See MG404, atpE
See MG405, atpB

See Prosite PDOC00137.

References: J. Bacterio. June 1997;(179)3746-3755. and Biochem. J. 1992;(285):881-888.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ATP synthase beta chain protein
sequences, e.g.residues 1-376 are 93% similar to ATPB_MYCPN.
It is similar to T.pallidum TP0402(flagellum-specific
ATP synthase), TP0528 and TP0427(V-type ATPase, subunit B),
TP0529 and TP0426(V-type ATPase, subunit A). It is also
similar to C.trachomatis CT669 and CT717(flagellar type ATPase),
CT308 and CT307(V-type sodium ATP synthase subunit A and B).

COGS Summary:  COGS Search
The phylogenetic pattern of COG0055 is ehgpcmy.
COG name: ATP synthase beta subunit/transription termination factor rho.
Functional Class: C,K
BeTs to e,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 135-146, 155-199, 221-258 are members of blocks
BL00152B,C,D(ATP synthase alpha and beta subunits proteins),
e.g. ATPB_AEGCO, ATPB_MYCGE. Residues 57-78 are matched to block PR00449A, concerned with
transforming protein P21 RAS signature, e.g. RAS1_YEAST.
Residues 58-73 are matched to block PR00364, concerned with
disease resistant protein signature, e.g. A54809. Residues 58-73, 288-316 are matched to blocks PR00318A,D,
concerned with alpha G-protein(transducin) proteins, e.g. GBA2_SCHPO.

ProDom Summary:  Protein Domain Search
Residues 44-94, 116-290, 292-326, 327-366 constitute defined domains
of ATPB_MYCGE. Residues 95-113 of ATPB_MYCPN support this assignment.

Paralogs:  Local Blast Search
MG399 is paralogously related to MG401(ATP synthase alpha chain),
residues 3-318 are 23% similar to MG401.

Pfam Summary:  Pfam Search
Residues 85 to 262 (E-value = 1.2e-87) place MG399 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)
Residues 269 to 376 (E-value = 5.3e-49) place MG399 in the ATP-synt_ab_C family which is described as ATP synthase alpha/beta chain, C terminal domain (PF00306)

PDB Hit:
gi|2981977|pdb|1SKY|E Chain E, Crystal Structure Of The Nucleotide Free Alpha3beta3 Sub-Complex Of F1-Atpase From The Thermophilic Bacillus Ps3 Atp Synthase, F1fo Atp Synthase, F1-Atpase, Alpha3beta3 Subcomplex Of F1-Atpase, Hydrolase Mol_id: 1; Molecule:

Gene Protein Sequence:
MFNVLGEPIDGKEPLPKKPKLSIHRNPPAFDEQPNTVDIFETGIKVIDLL
TPYVRGGKIGLFGGAGVGKTVLVQELIHNIAKEHSGLSVFAGVGERTREG
NDLYYEMIQGGVIDKTVLVFGQMNEPPGARMRVALTALTMAEYFRDHDNQ
NVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAIEMGKLQERIAST
KTGSITSVQAIYVPADDLTDPAPATTFTHLDAKTVLDRNIAALGIFPAIN
PLESTSRLLDPSVVGINHYKVALGVQNILQRFAELQDIIAILGIDELSDE
DKIIVERARRIRNFLSQPFFVAEKFSGIAGKYVSLNDTVQSFKEILEGKH
DHLPEQAFFYVGTIQEAVEKAKRLNQEFDKTK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCAATGTTTTAGGTGAACCCATTGATGGAAAAGAACCATTACCAAA
AAAACCAAAGCTATCAATCCATCGTAACCCACCTGCTTTTGATGAACAAC
CAAATACTGTTGATATTTTTGAAACAGGAATAAAAGTAATTGATCTTTTA
ACTCCTTACGTTAGGGGGGGTAAAATTGGTTTATTTGGAGGAGCTGGTGT
TGGGAAAACTGTTTTGGTGCAAGAATTAATTCATAACATTGCCAAAGAAC
ATTCTGGTTTAAGTGTATTTGCTGGAGTTGGTGAAAGAACAAGAGAAGGT
AATGATCTTTACTATGAAATGATTCAAGGTGGGGTGATTGATAAAACAGT
TTTAGTTTTTGGCCAAATGAATGAACCACCAGGAGCTAGAATGAGAGTTG
CTTTAACTGCTTTAACAATGGCAGAATATTTTCGTGATCATGATAATCAG
AATGTGCTGTTATTCATTGACAATATTTTTCGTTTTACTCAAGCAGGTAG
TGAGGTTTCAGCATTACTTGGTAGAATGCCATCTGCTGTTGGCTATCAAC
CAACTTTAGCTATTGAAATGGGTAAGTTACAAGAAAGAATTGCTTCTACC
AAAACAGGTTCTATTACATCTGTTCAAGCTATCTATGTTCCAGCAGATGA
TCTAACAGACCCAGCACCTGCAACAACATTTACCCATCTTGATGCTAAAA
CAGTGTTGGATCGTAATATTGCAGCACTAGGTATTTTTCCAGCAATTAAT
CCTTTAGAATCAACAAGTCGTTTATTAGATCCTAGTGTTGTTGGTATCAA
CCATTATAAAGTCGCTTTAGGAGTGCAAAATATCTTGCAGCGTTTTGCAG
AATTACAAGATATCATTGCTATACTAGGGATTGATGAATTGTCTGATGAA
GATAAGATTATTGTTGAAAGAGCAAGAAGGATACGTAACTTTTTATCCCA
ACCTTTTTTTGTTGCTGAAAAGTTTTCAGGTATTGCAGGTAAATATGTAT
CTTTAAATGATACTGTTCAATCTTTTAAAGAAATTTTGGAAGGTAAGCAT
GATCATTTGCCTGAACAAGCATTCTTTTATGTTGGAACCATTCAAGAGGC
TGTTGAAAAAGCAAAAAGATTAAATCAAGAGTTTGATAAAACTAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy