Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR301 IGR297 IGR298 IGR299 IGR295 IGR302 IGR300 IGR296 atpC, - MG398 rpiB,lacA, - MG396 atpF, - MG403 atpG, - MG400 atpD, - MG399 glyA, - MG394 atpA, - MG401 MG395 MG397 atpC, - MG398 rpiB,lacA, - MG396 atpF, - MG403 atpG, - MG400 atpD, - MG399 glyA, - MG394 atpA, - MG401 MG395 MG397 Type: inverted, Name:  - 57 Type: inverted, Name:  - 63 atpC, - MG398 rpiB,lacA, - MG396 atpF, - MG403 atpG, - MG400 atpD, - MG399 glyA, - MG394 atpA, - MG401 MG395 MG397 atpH, - MG402 atpH, - MG402
* Calculated from Protein Sequence

Gene ID: MG398

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
atpC  

Definition:
ATP synthase F1, subunit epsilon

Gene Start:
502823

Gene Stop:
502425

Gene Length:
399

Molecular Weight*:
15135

pI*:
10.53

Net Charge*:
9.67

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
See MG399, atpD
See MG400, atpG
See MG401, atpA
See MG402, atpH
See MG403, atpF
See MG404, atpE
See MG405, atpB

Function: Produces ATP from ADP in the presence of a proton gradient across the membrane. F-type ATPases have 2 components: CF(1) - the catalytic core and CF(0) - the membrane proton channel. CF(1) has five subunits: Alpha(3), Beta(3), Gamma(1), Delta(1) and Epsilon(1). CF(0) has three main subunits: A, B and C.

References: J. Bacterio. June 1997;(179)3746-3755. and Biochem. J. 1992;(285):881-888.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ATP synthase epsilon chain protein
sequences, e.g. residues 1-133 are 77% similar to ATPE_MYCPN.
MG398 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.


ProDom Summary:  Protein Domain Search
Residues 14-81 constitute a defined domain of ATPE_MYCGE.
Residues 70-124 are 35% similar to a hypothetical 26.4 KD
protein in PUT2-SRB2 intergenic region domain represented
by YHJ8_YEAST.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 3 to 85 (E-value = 1e-26) place MG398 in the ATP-synt_DE_N family which is described as ATP synthase, Delta/Epsilon chain, beta-sandwich domain (PF02823)
Residues 87 to 133 (E-value = 6.5e-08) place MG398 in the ATP-synt_DE family which is described as ATP synthase, Delta/Epsilon chain, long alpha-helix domain (PF00401)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
84  
133

PDB Hit:


Gene Protein Sequence:
MKLLRFLVLSPSGIKLDKTIISAQVKTTEGYIGLNFNRAPLIAAIQSHLC
KIIFADQTKREAIIGAGLMLIKKTEAKIFTENFVFADEVDINETLKRKTE
LERKIHHIKDAKLNVKIEQNLMFELLKLSSKKK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGTTATTGCGCTTTTTGGTACTTAGTCCTAGTGGCATAAAACTAGA
TAAAACCATTATTAGTGCGCAAGTTAAAACTACTGAAGGTTACATAGGAT
TAAATTTTAATCGCGCTCCTTTGATTGCTGCTATTCAATCCCATCTGTGC
AAAATTATTTTTGCTGATCAAACAAAAAGAGAAGCAATTATTGGTGCTGG
TTTAATGCTTATTAAAAAAACAGAAGCTAAGATTTTCACAGAAAATTTTG
TTTTTGCTGATGAAGTTGATATTAATGAAACCTTAAAAAGAAAAACAGAA
CTTGAAAGAAAAATTCACCATATCAAGGATGCTAAGCTAAACGTTAAAAT
TGAACAAAATTTAATGTTTGAACTATTAAAACTTTCAAGTAAGAAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy