Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR301 IGR297 IGR298 IGR299 IGR295 IGR293 IGR294 IGR300 IGR296 groES, - MG393 atpC, - MG398 rpiB,lacA, - MG396 atpG, - MG400 atpD, - MG399 glyA, - MG394 atpA, - MG401 MG395 groEL, - MG392 MG397 groES, - MG393 atpC, - MG398 rpiB,lacA, - MG396 atpG, - MG400 atpD, - MG399 glyA, - MG394 atpA, - MG401 MG395 groEL, - MG392 MG397 Type: inverted, Name:  - 57 Type: inverted, Name:  - 63 groES, - MG393 atpC, - MG398 rpiB,lacA, - MG396 atpG, - MG400 atpD, - MG399 glyA, - MG394 atpA, - MG401 MG395 groEL, - MG392 MG397
* Calculated from Protein Sequence

Gene ID: MG396

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpiB  lacA  

Definition:
galactoside acetyltransferase (galactose-6-phosphate isomerase)

Gene Start:
500719

Gene Stop:
500264

Gene Length:
456

Molecular Weight*:
16877

pI*:
7.43

Net Charge*:
0.81

EC:
5.3.1.-  5.3.1.26  5.3.1.6  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbon fixation
Fructose and mannose metabolism
Galactose metabolism
Pentose and glucuronate interconversions
Pentose phosphate cycle
Tyrosine metabolism

Comment:
Galactose-6-phosphate isomerase is involved in the tagatose 6-phosphate pathway of lactose catabolism in bacteria. It is a heteromultimeric protein consisting of the lacA and lacB subunits in Lactococcus and Staphlyococcus bacteria. Experimental evidence has indicated that expression of both LacA and LacB is required to obtain galactose-6-phosphate isomerase activity. The tagatose 6-phosphate pathway genes often form a gene cluster consisting of the lacABCDFEGX in lactococcus and streptococcus.

Ribose-5-P isomerase (rpi) is involved in the nonoxidative branch of the pentose phosphate pathway. Although E.coli contains both rpiA and rpiB, both enzymes are not necessary for catalyzing the isomerization step, indicating that one copy of rpi is sufficient. (J Bacteriol 1996 178:1003-1011).


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ribose phosphate isomerase B and to
galactosidase acetyltransferase sequences, e.g. residues 5-150 are
40% similar to YWLF_BACSU; 5-144 are 40% similar to the lacA protein
of H. pylori (AE000571). Residues 1-150 are 66% similar to Y396_MYCPN.
MG396 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0698 is e-gpc--.
COG name: Uncharacterized ACR - Galactose 6-phosphate isomerase subunit homolog.
Functional Class: R
BeTs to e,g,c.

Blocks Summary:  Blocks Search
NONE.

ProDom Summary:  Protein Domain Search
Residues 5-143 constitute a hypothetical LACA/RPIB family
protein MG396 domain of Y396_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 65 to 145 (E-value = 1.7e-53) place MG396 in the LacAB_rpiB family which is described as Ribose/Galactose Isomerase (PF02502)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
152

PDB Hit:


Gene Protein Sequence:
MSFNIFIASDHTGLTLKKIISEHLKTKQFNVVDLGPNYFDANDDYPDFAF
LVADKVKKNSDKDLGILICGTGVGVCMAANKVKGVLAALVVSEKTAALAR
QHDNANVLCLSSRFVTDSENIKIVDDFLKANFEGGRHQRRIDKIIRYEKE
TE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTTTTAATATCTTTATTGCTTCTGATCATACCGGTTTAACTCTTAA
AAAAATTATTAGTGAACACCTAAAGACTAAGCAGTTTAATGTAGTTGATC
TTGGCCCTAATTATTTTGATGCTAATGATGATTATCCTGACTTTGCTTTT
TTGGTAGCTGATAAGGTCAAGAAAAATTCTGATAAAGATCTTGGGATACT
AATTTGCGGTACTGGTGTTGGGGTTTGTATGGCAGCAAATAAAGTAAAAG
GAGTATTAGCGGCTTTGGTTGTTAGTGAGAAAACAGCAGCTTTAGCTAGA
CAACATGATAATGCCAATGTTTTATGTCTTTCCAGTCGTTTTGTAACTGA
CAGTGAAAACATTAAAATAGTGGATGATTTTCTCAAAGCTAATTTTGAAG
GTGGTAGACACCAAAGACGGATAGATAAGATTATTCGATATGAAAAAGAA
ACTGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy