Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR297 IGR298 IGR295 IGR293 IGR292 IGR291 IGR294 IGR296 groES, - MG393 atpC, - MG398 rpiB,lacA, - MG396 glyA, - MG394 lap, - MG391 MG395 groEL, - MG392 MG397 MG390 groES, - MG393 atpC, - MG398 rpiB,lacA, - MG396 glyA, - MG394 lap, - MG391 MG395 groEL, - MG392 MG397 MG390 Type: inverted, Name:  - 57 Type: inverted, Name:  - 63 groES, - MG393 atpC, - MG398 rpiB,lacA, - MG396 glyA, - MG394 lap, - MG391 MG395 groEL, - MG392 MG397 MG390
* Calculated from Protein Sequence

Gene ID: MG394

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glyA  

Definition:
serine hydroxymethyl transferase

Gene Start:
498306

Gene Stop:
497089

Gene Length:
1218

Molecular Weight*:
44738

pI*:
10.00

Net Charge*:
15.83

EC:
2.1.2.1  

Functional Class:
Amino acid biosynthesis; Serine family  
Central intermediary metabolism; Other  

Pathway: pathway table
Amino Acid Metabolism; Glycine, serine and threonine metabolism
Amino Acid Metabolism; Lysine degradation
Energy Metabolism; Methane metabolism
Metabolism of Cofactors, Vitamins, and Other Substances; One carbon pool by folate
Metabolism of Other Amino Acids; Cyanoamino acid metabolism

Comment:
This enzyme is involved in the interconversion of glycine and serine. In E.coli, it is homotetrameric. Pyridoxal phosphate is a cofactor in the reaction.

See Prosite PDOC00090.

From Prosite:

Serine hydroxymethyltransferase (EC 2.1.2.1) (SHMT) catalyzes the transfer of the hydroxymethyl group of serine to tetrahydrofolate to form 5,10-methylenetetrahydrofolate and glycine. In vertebrates, it exists in a cytoplasmic and a mitochondrial form whereas only one form is found in prokaryotes. Serine hydroxymethyltransferase is a pyridoxal-phosphate containing enzyme. The pyridoxal-P group is attached to a lysine residue around which the sequence is highly conserved in all forms of the enzyme.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to serine hydroxymethyl transferase
sequences, e.g. residues 1-406 are 77% similar to GLYA_MYCPN.
MG394 is similar to T.pallidum TP0329, a predicted
serine hydroxymethyltransferase. It is also similar to C.trachomatis
U serine hydroxymethyltransferase, sequence CT432.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0112 is ehgpcmy.
COG name: Glycine hydroxymethyltransferase.
Functional Class: E
BeTs to e,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 2-364 represent 8 blocks -- BL00096A-G
(Serine hydroxymethyltransferase pyridoxal-phosphate attachment).

ProDom Summary:  Protein Domain Search
Residues 9-211, 212-298, 300-376 constitute defined
domains of GLYA_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 3 to 371 (E-value = 2.2e-195) place MG394 in the SHMT family which is described as Serine hydroxymethyltransferase (PF00464)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
184  
204

PDB Hit:


Gene Protein Sequence:
MFSKVRLLLNKELQRQRENICLIASENYVSQDILAVTGSVLTNKYAEGYP
SKRFYQGCEVVDESENLAIESCKTLFGAQWANVQPHSGSSANYAVYLALL
KPGDTILGLDLNCGGHLTHGSPVNFSGKQYQAVTYSLDFETETLDYDAIL
QIALEHKPKLIICGFSNYSRTVDFKKFSAIAKQVNAYLLADIAHIAGFIA
AGLHQNPLPFVDVVTSTTHKTLRGPRGGIIMSNNQAIIKKLDSGVFPGCQ
GGPLQHVIAAKYVCFKEALNPKFKQYMQQVKDNALAMANWFLKQGYRVVS
KGTETHLFSLVVGNGKDVALWLQKANIVLNMNTIPFETKSAFSPSGIRLG
TPAMTTRGFKTNDFIFVASLIDKVIKSNGNQKVISQTKTAVLNLLKRFPL
YKGLAY

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTCAAAGGTAAGACTTTTACTTAATAAAGAGTTACAACGTCAAAG
AGAAAACATTTGTTTAATTGCTTCAGAAAATTACGTTAGCCAAGACATAT
TAGCTGTAACTGGTTCAGTATTAACAAATAAATATGCAGAAGGCTATCCC
AGTAAACGTTTTTATCAAGGCTGTGAAGTTGTTGATGAATCTGAAAACTT
AGCCATTGAAAGTTGCAAAACTTTATTTGGAGCACAATGGGCTAATGTCC
AACCTCATTCTGGATCATCTGCTAACTATGCAGTTTACTTAGCATTGTTA
AAACCAGGAGATACTATCTTAGGATTAGATCTTAATTGTGGTGGTCATTT
AACCCATGGTAGCCCCGTTAATTTTTCAGGTAAGCAATATCAAGCAGTAA
CTTATTCGTTAGATTTTGAAACAGAAACTCTTGATTATGATGCAATTCTT
CAAATTGCTCTCGAACACAAACCAAAGTTAATTATTTGTGGTTTTTCTAA
CTATTCTAGGACTGTTGACTTTAAAAAATTTAGTGCAATTGCAAAACAAG
TTAATGCGTATCTTTTAGCTGATATTGCCCATATTGCTGGTTTCATCGCT
GCAGGTTTGCACCAAAACCCTTTGCCTTTTGTGGATGTTGTCACTTCAAC
AACTCATAAAACTTTGCGTGGTCCTAGGGGGGGTATCATTATGTCTAACA
ACCAAGCAATTATCAAAAAGCTTGATAGTGGAGTATTTCCTGGATGTCAG
GGTGGACCTTTACAACATGTGATAGCAGCTAAATATGTTTGTTTTAAAGA
AGCTTTGAATCCAAAGTTTAAGCAGTATATGCAACAAGTTAAAGATAATG
CTTTAGCAATGGCAAATTGATTTTTAAAGCAGGGTTATCGTGTTGTGTCA
AAAGGTACTGAAACCCACTTATTTTCATTAGTGGTTGGTAATGGTAAAGA
TGTTGCGTTGTGGTTACAAAAAGCTAACATTGTTTTGAATATGAATACAA
TCCCTTTTGAAACAAAATCTGCTTTTAGTCCTTCAGGTATTAGACTTGGA
ACTCCTGCAATGACAACCAGAGGTTTTAAAACTAATGACTTTATTTTTGT
TGCCAGTTTGATTGATAAGGTTATTAAAAGTAATGGTAATCAAAAGGTAA
TTAGTCAAACAAAAACAGCTGTTTTAAATCTCTTAAAACGCTTTCCGCTC
TATAAGGGTTTAGCTTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy