Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR290 IGR295 IGR293 IGR292 IGR291 IGR294 IGR289 IGR288 groES, - MG393 MG389 era, - MG387 glyA, - MG394 lap, - MG391 MG395 groEL, - MG392 MG390 MG386 groES, - MG393 MG389 era, - MG387 glyA, - MG394 lap, - MG391 MG395 groEL, - MG392 MG390 MG386 Type: inverted, Name:  - 57 Type: inverted, Name:  - 63 groES, - MG393 MG389 era, - MG387 glyA, - MG394 lap, - MG391 MG395 groEL, - MG392 MG390 MG386 MG388 MG388
* Calculated from Protein Sequence

Gene ID: MG391

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lap  

Definition:
cytosol aminopeptidase (leucyl aminopeptidase) (leucine aminopeptidase) (peptidase S)

Gene Start:
494967

Gene Stop:
493627

Gene Length:
1341

Molecular Weight*:
49096

pI*:
8.96

Net Charge*:
9.57

EC:
3.4.11.1  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous enzymes

Comment:
See Prosite PDOC00548.

From Prosite:

Cytosol aminopeptidase is a eukaryotic cytosolic zinc-dependent exopeptidase that catalyzes the removal of unsubstituted amino-acid residues from the N-terminus of proteins. This enzyme is often known as leucine aminopeptidase.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to cytosol aminopeptidase and related
sequences, e.g. residues 1-447 are 71% similar to AMPL_MYCPN.
MG391 is similar to C.trachomatis CT045, a leucyl aminopeptidase.
It shows no significant similarities to T.pallidum sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0260 is ehgpc--.
COG name: Leucyl aminopeptidase.
Functional Class: E
BeTs to h,g,c.

Blocks Summary:  Blocks Search
Residues 215-426 represent 7 matches to blocks BL00631A-F,
(Cytosol aminopeptidase proteins).

ProDom Summary:  Protein Domain Search
Residues 1-108, 135-421 constitute defined domains of AMPL_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 135 to 439 (E-value = 4.1e-193) place MG391 in the Peptidase_M17 family which is described as Cytosol aminopeptidase family, catalytic domain (PF00883)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
52  
79
transmembrane  
313  
340

PDB Hit:
gi|1127256|pdb|1LCP|A Chain A, Molecule: Leucine Aminopeptidase; Chain: A, B; Ec: 3.4.11.1; Heterogen: L-Leucine Phosphonic Acid

Gene Protein Sequence:
MRINKPFSDDSNTVVFVSSKTYGVKEEAAHNPNVEFGVVLPTDFPAFNRA
LVQFLKRKKTKLNINLDSLIELYKKNENSGCFHTAIKTVITSVTFCETTP
FTMKTKPEKNVEVAVQCAVEYHNLVKEYETVGEYVNLARELQDTPSDLLY
SEVFVKHFEKAASKLPVKIKVLKQSDLIKKKMGLLLGVNQGSEREARLLV
ISYQANKNSKEKLAFVGKGITYDSGGMNIKTGDYMRGMKYDMSGAAIVCS
TVLALAKNKVKTNVVAVAALTENLPGAKAQRPDDIKIAYNGKSVEIDNTD
AEGRLVLADAITYAAKDLAATHIIDVATLTGLMSYILSTTYTGIFSTCDH
QWESFKKAACSAGEPVWRLPMHPDYLKPLQLTKLADLQNSTSARGAGSSR
AACFLAEFREGVSLIHCDIASTASIENLGQGVLVRTLYERASQLANK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAATAAATAAACCTTTTAGTGATGATAGCAACACAGTTGTTTTTGT
GAGTTCAAAAACATATGGTGTAAAAGAAGAAGCTGCACATAATCCTAATG
TTGAATTTGGTGTTGTTTTACCAACTGATTTTCCTGCTTTCAACCGTGCT
TTAGTTCAATTTCTTAAAAGAAAGAAAACCAAATTAAACATTAATCTTGA
CAGTCTTATAGAACTTTATAAGAAAAATGAAAATAGTGGTTGTTTTCATA
CTGCGATAAAAACTGTTATTACAAGTGTTACTTTTTGTGAAACTACTCCT
TTCACAATGAAAACCAAACCTGAAAAAAATGTTGAAGTTGCTGTTCAATG
TGCTGTTGAATATCACAACTTAGTTAAAGAATATGAAACAGTAGGCGAAT
ATGTTAACCTAGCAAGAGAATTACAAGACACTCCTTCAGATCTACTTTAT
TCAGAAGTATTTGTTAAACATTTTGAAAAGGCTGCAAGTAAATTGCCTGT
AAAAATAAAAGTTCTTAAACAATCAGATCTAATTAAGAAAAAAATGGGTT
TACTTTTAGGGGTTAATCAAGGCTCTGAAAGAGAAGCACGTTTACTTGTT
ATTAGTTATCAAGCTAATAAAAATTCCAAAGAAAAACTTGCTTTTGTAGG
GAAAGGAATTACTTATGATTCAGGCGGAATGAACATTAAAACAGGTGATT
ATATGCGTGGCATGAAATATGACATGAGTGGTGCGGCTATAGTATGTTCT
ACTGTTTTGGCATTAGCTAAAAACAAGGTTAAAACCAATGTTGTTGCAGT
AGCAGCTCTTACTGAAAATCTTCCTGGTGCTAAGGCGCAACGTCCTGATG
ACATTAAGATAGCATACAATGGTAAAAGTGTTGAAATAGATAACACTGAT
GCTGAAGGAAGATTGGTTTTAGCTGATGCTATTACATATGCTGCTAAGGA
TTTAGCTGCTACACATATTATTGATGTAGCAACCCTTACTGGTTTAATGT
CATACATATTGAGTACTACCTATACAGGTATTTTCAGTACTTGTGATCAC
CAGTGAGAATCTTTTAAAAAAGCAGCATGTAGTGCAGGTGAACCTGTATG
AAGATTACCTATGCACCCTGATTATTTAAAACCTTTACAGCTAACAAAAC
TTGCTGATTTGCAAAATTCTACTAGTGCAAGAGGTGCTGGATCTTCAAGA
GCAGCTTGTTTCCTTGCAGAATTTAGAGAAGGTGTATCTTTGATCCATTG
TGATATTGCATCAACTGCTTCCATTGAGAACCTTGGACAAGGTGTTTTAG
TGAGAACCTTGTACGAACGTGCTAGTCAGCTTGCAAATAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy