Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR285 IGR287 IGR284 MG384.1 MG385 obg, - MG384 MG386 udk, - MG382 MG381 MG384.1 MG385 obg, - MG384 MG386 udk, - MG382 MG381 Type: direct, Name:  - 28 Type: tandem, Name:  - 18 Type: tandem, Name:  - 19 Type: direct, Name:  - 28 MG384.1 MG385 obg, - MG384 MG386 outB, - MG383 outB, - MG383 udk, - MG382 MG381 gidB, - MG380 gidB, - MG380
* Calculated from Protein Sequence

Gene ID: MG385

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
probable glycerophosphodiester phosphodiesterase

Gene Start:
484699

Gene Stop:
483992

Gene Length:
708

Molecular Weight*:
27719

pI*:
10.30

Net Charge*:
12.82

EC:
3.1.4.46  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism
Phospholipid degradation

Comment:
Hydrolyzes glycerophosphodiesters to alcohol and sn-glycerol 3-phosphate.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several hits to hypothetical proteins and
to glycerophosphodiester phosphodiesterase sequences. Residues 1-236
are 61% similar to Y385_MYCPN. Weaker matches to glycerolphosphoryl
diester phosphodiestease sequences, e.g. residues 7-108 are 30% similar
to GLPQ_BACSU. MG385 shows no significant similarities to T.pallidum
or C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0584 is ehgp--y.
COG name: Glycerophosphoryl diester phosphodiesterase.
Functional Class: C
BeTs to e,g,y.

Blocks Summary:  Blocks Search
NONE.

ProDom Summary:  Protein Domain Search
Residues 9-59, 60-91, 92-112, 133-231 constitute defined
domains of Y385_MYCGE.

Paralogs:  Local Blast Search
MG385 is paralogously related to MG293(glycerophosphoryl diester
phosphodiesterase): residues 3-231 are 36% similar to MG293.

Pfam Summary:  Pfam Search
Residues 10 to 234 (E-value = 1.8e-06) place MG385 in the GDPD family which is described as Glycerophosphoryl diester phosphodiesterase family (PF03009)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
109
coil-coil  
111  
138

PDB Hit:


Gene Protein Sequence:
MRKQFLIAYRGYSSIAPENTKLAFQAAQVFDFDGIWIDIQLTKDKQIVVT
HKENFKVSNKNLNLNQINLVDLKKVNLASEFKLKVTSQQIQTLKEVLTQF
IQPFKYLLIHIKDDKENNNSLLEQLNLLCKDFVLAKEKMILLSSNFHIIK
LINETFKGFKTGFVIANKKALLVASRDELMRYCRFLVPNESFYHKNCKEI
QNLGLPVILWVIKGLLRYQFYENDRFVKFQITAQIY

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGAAAACAGTTTTTAATAGCTTATCGCGGTTATAGTTCTATTGCACC
AGAAAACACCAAATTAGCATTTCAAGCAGCCCAAGTTTTTGATTTTGATG
GTATTTGAATTGATATTCAATTAACCAAAGATAAACAAATAGTAGTAACT
CATAAAGAAAACTTTAAAGTTTCTAATAAAAACTTGAATTTAAACCAAAT
TAATTTAGTTGATCTTAAAAAGGTTAACCTTGCAAGTGAATTTAAGCTTA
AGGTAACTTCACAACAAATTCAAACTTTAAAGGAAGTTTTAACGCAATTT
ATTCAGCCCTTTAAATATTTGCTGATTCATATTAAAGATGATAAAGAAAA
TAACAATTCATTATTAGAACAGTTGAATTTGCTTTGCAAAGATTTTGTCT
TAGCTAAAGAAAAAATGATTTTGTTAAGTAGTAATTTTCATATCATTAAG
TTAATAAATGAGACTTTCAAAGGCTTTAAAACCGGTTTTGTAATTGCAAA
CAAAAAAGCTTTATTAGTAGCTTCTAGAGACGAATTAATGAGATATTGCC
GTTTTTTAGTGCCAAACGAGAGTTTTTATCATAAGAACTGCAAAGAAATT
CAAAACCTGGGATTACCAGTTATTCTTTGAGTTATCAAGGGTCTTCTTCG
TTATCAATTTTATGAAAACGATCGCTTTGTGAAATTTCAAATTACTGCAC
AAATTTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy