Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR285 IGR287 IGR284 MG384.1 MG385 obg, - MG384 MG386 udk, - MG382 MG381 gidA, - MG379 MG384.1 MG385 obg, - MG384 MG386 udk, - MG382 MG381 gidA, - MG379 Type: direct, Name:  - 28 Type: tandem, Name:  - 18 Type: tandem, Name:  - 19 Type: direct, Name:  - 28 Type: inverted, Name:  - 63 MG384.1 MG385 obg, - MG384 MG386 outB, - MG383 outB, - MG383 udk, - MG382 MG381 gidA, - MG379 gidB, - MG380 gidB, - MG380
* Calculated from Protein Sequence

Gene ID: MG384.1

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
483818

Gene Stop:
483372

Gene Length:
447

Molecular Weight*:
17715

pI*:
0.00

Net Charge*:
0.00

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:
This protein is not in the original genbank record.

Blast Summary:  PSI-Blast Search
Residues 1-133 are 42% similar to residues 1-133 of hypothetical protein H03_orf152 - Mycoplasma pneumoniae.
Residues 14-144 are 25% similar to UU462, a hypothetical protein sequence.
No significant similarity to C.trachomatis, C.pneumoniae, or T.pallidum.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 32-149 are 49% similar to a defined domain of P75213_MYCPN, defined as: H03_ORF152 PROTEIN.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MGKEIEPIFDLVLLWFLFVPLLIYLFLAFFLFAFTKYIIWELIPFCYSTA
FTLIVLFLSGIIPMAWNSWIILLRFFLVLITLMLSFFLLNKMTNFFLIRS
KYAIIIAENLLKTGKSKTKNRQKLQQIQSDLERKKSAEIVFKIKKKKPK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTAAGGAAATAGAGCCCATTTTTGACTTAGTTTTGTTGTGATTTTT
ATTTGTTCCTTTACTAATTTATCTTTTTTTAGCCTTTTTTTTATTTGCTT
TTACTAAATACATTATTTGGGAATTAATTCCTTTTTGCTATTCTACTGCT
TTTACTTTAATAGTTCTTTTTTTATCAGGAATAATACCAATGGCTTGAAA
TAGTTGAATTATCTTACTTCGATTTTTTTTAGTTCTAATAACATTAATGC
TAAGTTTTTTTCTTTTGAATAAAATGACTAACTTTTTTTTAATCAGATCA
AAATATGCAATAATAATTGCTGAAAATCTCTTAAAGACAGGTAAATCTAA
AACTAAAAATCGACAAAAGTTGCAACAAATTCAAAGTGATCTAGAAAGAA
AAAAATCTGCAGAAATCGTTTTTAAAATAAAGAAAAAGAAACCAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy