Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR285 IGR287 IGR284 MG384.1 MG385 obg, - MG384 MG386 udk, - MG382 MG381 gidA, - MG379 MG384.1 MG385 obg, - MG384 MG386 udk, - MG382 MG381 gidA, - MG379 Type: direct, Name:  - 28 Type: tandem, Name:  - 18 Type: tandem, Name:  - 19 Type: direct, Name:  - 28 Type: inverted, Name:  - 63 MG384.1 MG385 obg, - MG384 MG386 outB, - MG383 outB, - MG383 udk, - MG382 MG381 gidA, - MG379 gidB, - MG380 gidB, - MG380
* Calculated from Protein Sequence

Gene ID: MG384

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
obg  

Definition:
probable OBG-related Spo0B-associated GTP-binding protein

Gene Start:
483369

Gene Stop:
482071

Gene Length:
1299

Molecular Weight*:
48155

pI*:
8.95

Net Charge*:
9.81

EC:
 

Functional Class:
Uncategorized  

Pathway: pathway table

Comment:
See MG024.

See Prosite PDOC00704.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to GTP binding proteins, e.g. residues 14-433
are 39% similar to OBG_BACSU. Residues 1-433 are 76% similar to Y384_MYCPN.
MG384 is similar to T.pallidum TP0742(GTP-binding protein (obg)),
TP0124(conserved hypothetical GTP-binding protein). It is also similar to
C.trachomatis CT418(OBG family of GTPases), CT092(YCHF family
of bacterial GTPases) sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0536 is .
COG name: Predicted GTPase.
Functional Class: R


Blocks Summary:  Blocks Search
Residues 17-57, 160-202, 274-291, 371-416 are members
of blocks BL00905A-D(GTP1/OBG family proteins).
Residues 161-176 are members of block BL00301A(GTP-binding
elongation factors proteins).

ProDom Summary:  Protein Domain Search
Residues 3-59, 60-159, 163-244, 245-285, 307-433, 317-433
constitute defined domains of Y384_MYCGE. In addition to
M.genitalium it also shows similarity to OBG_BACSU.

Paralogs:  Local Blast Search
MG384 is paralogously related to MG024(GTP-binding protein),
residues 159-244 are 36% similar to MG024. It is also weakly related to
MG387 (GTP-binding protein era homolog).

Pfam Summary:  Pfam Search
Residues 16 to 287 (E-value = 1.6e-135) place MG384 in the GTP1_OBG family which is described as GTP1/OBG family (PF01018)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
264  
335

PDB Hit:


Gene Protein Sequence:
MAITDYCECRFTAGNGGNGIIAWKREAHYDKGGPGGGNGGNGGNVILQAD
HNCDSLFFLKNKKHLFAEDGQNGKPDLAHGKNGSDLLIKVPIGTTVKNLE
NNSVLVDFVHDKQSFILCFGGKGGKGNAAFKSPIMRAPNLYENGDKGEIL
NVSLEVKYLANVGIVGFPNSGKSTLISKLSNAKPKIANYRFTTLIPVLGV
VKYQNNSLVFADIPGLIENASEGSGLGHDFLRHIERCEILIHLISLDPVD
NDDPCKAYLQIMDELSKYSPLLVKKKMLVVANKIDVNEGEKRFKKLEKFL
QKKSISVLKISALKKELGNLLDRVFELYNKTISQFGANKFSLPMELEKHY
VFQNTNENNNDPLNIEKDSLNRWIVNCKRLRYWFDKIPQTTLDNIRRLGN
KIKEIGIEDQLKSVGAKKGDIIFFDGCEFVIND

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTATTACAGATTATTGTGAGTGTCGCTTTACTGCTGGAAATGGTGG
TAATGGAATCATAGCATGAAAAAGAGAAGCACATTATGATAAAGGTGGTC
CTGGTGGTGGTAATGGTGGTAATGGTGGTAATGTTATTTTGCAAGCTGAT
CATAACTGCGATTCACTTTTTTTCTTGAAGAATAAAAAACACCTGTTTGC
AGAAGATGGACAAAATGGTAAACCAGATTTAGCACATGGTAAAAATGGTT
CAGATCTTTTAATTAAAGTGCCAATAGGAACAACAGTTAAAAACTTAGAA
AATAATAGTGTATTGGTGGATTTTGTTCATGATAAACAGAGTTTTATTTT
GTGTTTTGGCGGAAAAGGCGGAAAAGGAAATGCTGCTTTTAAAAGCCCAA
TTATGCGTGCTCCTAATCTATATGAAAATGGTGATAAAGGAGAGATTTTA
AACGTTAGTTTGGAAGTTAAATATTTAGCTAATGTAGGAATTGTTGGTTT
TCCAAATTCAGGTAAATCAACACTAATCTCCAAACTTTCAAATGCCAAAC
CTAAAATTGCAAACTATCGCTTTACTACTTTAATACCCGTACTTGGTGTA
GTTAAATATCAAAATAATAGTTTAGTTTTTGCTGATATTCCTGGTTTGAT
TGAAAATGCTAGTGAAGGAAGTGGGTTAGGACATGATTTTTTACGGCATA
TAGAGAGGTGTGAAATATTAATTCATTTAATTTCACTTGATCCTGTAGAT
AATGATGATCCTTGCAAAGCATATTTACAAATAATGGATGAACTTTCAAA
ATATTCTCCCCTTCTAGTTAAAAAAAAGATGCTTGTTGTAGCTAATAAAA
TTGATGTTAATGAAGGTGAGAAACGGTTTAAAAAATTAGAAAAATTTCTT
CAAAAAAAATCTATTTCTGTATTAAAAATTTCTGCTTTAAAGAAAGAATT
AGGCAATTTACTTGATAGAGTTTTTGAACTTTACAATAAAACAATTTCCC
AATTTGGAGCTAATAAGTTTAGTTTGCCAATGGAACTTGAGAAGCATTAT
GTTTTTCAAAATACCAATGAAAATAATAACGACCCTTTAAATATTGAAAA
AGATAGTTTAAACAGATGAATTGTTAATTGTAAACGTCTAAGATATTGAT
TTGATAAAATTCCACAAACTACGCTTGATAACATTCGTCGCTTAGGAAAT
AAAATTAAAGAAATCGGTATTGAAGATCAATTAAAATCCGTTGGTGCTAA
AAAAGGTGATATTATTTTCTTTGATGGTTGTGAATTTGTAATTAATGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy