Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR285 IGR287 IGR283 IGR284 MG384.1 MG385 obg, - MG384 argS, - MG378 MG386 udk, - MG382 MG381 gidA, - MG379 MG384.1 MG385 obg, - MG384 argS, - MG378 MG386 udk, - MG382 MG381 gidA, - MG379 Type: direct, Name:  - 28 Type: tandem, Name:  - 18 Type: tandem, Name:  - 19 Type: direct, Name:  - 28 Type: inverted, Name:  - 63 MG384.1 MG385 obg, - MG384 argS, - MG378 MG386 outB, - MG383 outB, - MG383 udk, - MG382 MG381 gidA, - MG379 gidB, - MG380 gidB, - MG380
* Calculated from Protein Sequence

Gene ID: MG383

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
outB  

Definition:
NH(3)-dependent NAD+ synthetase

Gene Start:
482075

Gene Stop:
481332

Gene Length:
744

Molecular Weight*:
28175

pI*:
9.35

Net Charge*:
4.64

EC:
6.3.5.1  

Functional Class:
Uncategorized  

Pathway: pathway table
Amino Acid Metabolism; Glutamate metabolism
Metabolism of Cofactors, Vitamins, and Other Substances; Nicotinate and nicotinamide metabolism

Comment:
A sporulation protein.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to NH(3)-dependent NAD+ synthetase and its
related sequences, e.g. residues 3-247 are 61% similar to NADE_MYCPN.
MG383 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0171 is e-gpcmy.
COG name: NAD synthase.
Functional Class: H
BeTs to e,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 26-45, 128-182 are matched to blocks BL01263B,E,
concerned with Uncharacterized protein family UPF0021 proteins, e.g. V136_DICDI.

ProDom Summary:  Protein Domain Search
Residues 15-52, 53-108, 109-188, 189-211, 212-248 constitute
defined domains of NADE_MYCGE. Residues 14-43, 106-205 are 43% and 34% similar to a hypothetical
80.7 KD protein in ERG7-NMD2 intergenic region domain
represented by YHN4_YEAST.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 58 to 241 (E-value = 1.8e-95) place MG383 in the NAD_synthase family which is described as NAD synthase (PF02540)

PDB Hit:
gi|2392477|pdb|1NSY|A Chain A, Crystal Structure Of Nh3-Dependent Nad+ Synthetase From Bacillus Subtilis Lyase, Amidotransferase, Nh3 Dependent, Atp Pyrophosphatase Mol_id: 1; Molecule: Nad Synthetase; Chain: A, B; Ec: 6.3.5.1

Gene Protein Sequence:
MTNLIKYLKELQNWLFDYVKKSKAKGVIFGLSGGIDSAVVAAIAKETFGF
ENHLALIMHINNSKLDFQATSELVKKMQFNSINIELEESFNLLVKTLGID
PKKDFLTAGNIKARLRMITLYAYAQKHNFLVLGTGNFVEYTLGYFTKWGD
GACDIAPLAWLLKEDVYKLAKHFNIPEIVITRAPTASLFEGQTDETEMGI
TYKELDQYLKGDLILSSEKQKIVLDLKAKAEHKHNSPLKFKHLYNFQN

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAATTTAATTAAATATTTAAAAGAACTCCAAAACTGGCTGTTTGA
TTATGTAAAAAAATCTAAAGCTAAAGGTGTTATTTTTGGCTTATCTGGAG
GAATTGATTCAGCAGTTGTTGCTGCTATTGCTAAAGAAACTTTTGGTTTT
GAAAACCATTTAGCTTTAATAATGCATATTAATAATTCAAAACTTGATTT
TCAAGCAACTAGTGAACTTGTTAAAAAAATGCAATTTAATAGTATTAACA
TTGAACTGGAAGAGAGTTTCAATCTGTTAGTAAAAACCCTTGGAATAGAT
CCAAAAAAAGATTTTTTAACAGCTGGTAACATTAAAGCACGTTTACGGAT
GATAACTTTATATGCTTATGCTCAAAAACACAACTTCTTAGTTTTAGGTA
CTGGTAATTTTGTAGAGTATACACTTGGTTATTTCACAAAATGAGGAGAT
GGAGCTTGTGATATTGCTCCTTTAGCATGGCTTTTAAAAGAGGACGTTTA
CAAATTAGCTAAGCATTTTAATATTCCTGAAATTGTAATCACAAGAGCGC
CAACTGCTAGTCTTTTTGAAGGGCAAACTGATGAGACAGAGATGGGCATT
ACTTATAAGGAACTTGATCAATATTTAAAAGGTGATTTAATACTTAGTTC
AGAAAAGCAAAAAATTGTTTTAGATTTGAAAGCAAAAGCAGAGCATAAAC
ATAATTCACCTTTGAAATTTAAACATCTCTATAATTTCCAGAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy