Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR285 IGR287 IGR283 IGR284 MG384.1 MG385 obg, - MG384 argS, - MG378 MG386 udk, - MG382 MG381 gidA, - MG379 MG384.1 MG385 obg, - MG384 argS, - MG378 MG386 udk, - MG382 MG381 gidA, - MG379 Type: direct, Name:  - 28 Type: tandem, Name:  - 18 Type: tandem, Name:  - 19 Type: direct, Name:  - 28 Type: inverted, Name:  - 63 MG384.1 MG385 obg, - MG384 argS, - MG378 MG386 outB, - MG383 outB, - MG383 udk, - MG382 MG381 gidA, - MG379 gidB, - MG380 gidB, - MG380
* Calculated from Protein Sequence

Gene ID: MG382

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
udk  

Definition:
uridine kinase

Gene Start:
480691

Gene Stop:
481329

Gene Length:
639

Molecular Weight*:
24910

pI*:
10.13

Net Charge*:
8.87

EC:
2.7.1.48  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to uridine kinase sequences, e.g. residues
3-212 are 74% similar to URK_MYCPN. MG382 is similar to T.pallidum TP0667, a predicted uridine
kinase sequence. It shows no significant similarities to
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0572 is ehgpc-y.
COG name: Uridine kinase/panthothenate kinase.
Functional Class: F,H
BeTs to h,g,c,y.

Blocks Summary:  Blocks Search
Residues 34-44 are matched to blocks BL00130A,F, concerned with,Uracil-DNA glycosylase proteins, e.g. UNG_DICDI.
Residues 5-30 are matched to blocks PR00193B, concerned with
myosin heavy chain signatures, e.g. S45574.

ProDom Summary:  Protein Domain Search
Residues 122-184, 63-121, 6-58 constitute defined domains of URK_MYCGE.
Residues 3-179 are 31% similar to a hypothetical 27.7 KD protein
in CPT1-SPC98 intergenic region domain represented by YNM9_YEAST.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 7 to 193 (E-value = 8.3e-31) place MG382 in the PRK family which is described as Phosphoribulokinase / Uridine kinase family (PF00485)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
97  
164

PDB Hit:


Gene Protein Sequence:
MDEKGILVAISGGSCSGKTTVAEMIYQLLSKKLKVAIICQDNYYKSYKNK
PLLKRKTINFDHPDAFDWKLLRSHIEDLLNGSIVNVPLYDYINYTRAKKT
AKIGPIDVVILEGLMPWFDEKLSRLSKLKIFIETNGEERLIRRIERDWQR
GRNIDSIIKQWREIVAPMYEIFVEKMKRNADLILPWSQRREVSTSVLDVA
IEHLFHKTVEKNN

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATGAAAAAGGGATTTTAGTTGCAATTAGTGGTGGTAGTTGCTCAGG
AAAAACTACTGTTGCTGAAATGATTTATCAACTTTTAAGTAAAAAATTAA
AAGTTGCGATCATCTGTCAAGATAACTATTACAAGTCCTATAAAAATAAG
CCATTATTAAAAAGAAAAACAATAAACTTTGATCATCCTGATGCTTTTGA
TTGAAAACTTTTAAGATCACACATTGAAGATCTTCTAAACGGTAGTATAG
TTAATGTTCCTTTATATGACTACATTAACTATACCAGAGCTAAAAAAACA
GCAAAAATTGGTCCAATTGATGTTGTTATTCTAGAGGGTTTAATGCCATG
ATTTGATGAAAAATTATCAAGACTTTCTAAGCTAAAAATATTTATAGAAA
CAAATGGGGAAGAACGTTTAATTAGAAGAATAGAAAGAGACTGACAAAGG
GGAAGAAATATTGATTCTATTATTAAACAGTGACGCGAAATAGTAGCACC
AATGTATGAAATATTTGTAGAAAAAATGAAGCGAAATGCTGATTTAATTC
TGCCTTGAAGTCAACGCAGAGAAGTAAGTACAAGTGTATTGGATGTCGCA
ATTGAACACTTATTTCACAAAACTGTTGAAAAAAATAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy