Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR285 IGR287 IGR281 IGR283 IGR282 IGR284 MG384.1 MG377 MG385 obg, - MG384 argS, - MG378 MG386 udk, - MG382 MG381 gidA, - MG379 MG384.1 MG377 MG385 obg, - MG384 argS, - MG378 MG386 udk, - MG382 MG381 gidA, - MG379 Type: tandem, Name:  - 18 Type: inverted, Name:  - 63 MG384.1 MG377 obg, - MG384 argS, - MG378 MG386 outB, - MG383 outB, - MG383 MG385 udk, - MG382 MG381 gidA, - MG379 gidB, - MG380 gidB, - MG380
* Calculated from Protein Sequence

Gene ID: MG381

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Mycoplasma-specific hypothetical protein

Gene Start:
479570

Gene Stop:
480223

Gene Length:
654

Molecular Weight*:
25485

pI*:
10.16

Net Charge*:
10.34

EC:
 

Functional Class:
Unknown; Mycoplasma-specific protein  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Single hit in gapped BLAST to Y381_MYCPN: residues 1-216 are
56% similar to this sequence. MG381 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-218 constitute a defined domain of Y381_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
117

PDB Hit:


Gene Protein Sequence:
MIKLGWASFSNTEFAQDIFIKFANQFYKQDDAGTILFELKKTLGVNQLDE
IEKNKKVIIVNQFQNSLGKFLLFNKENTKRINSLANEHISSFLKKIFRLS
GFKDMLIDVQHHKKLQKCLLREIHLLVCLINSNQFSDELMQIIEWYQYLK
KHSSKLFVITASSDKKPVIEPTINEYKAIFGEYLSSFHLDLKNNQSNDLF
QKLLDQIKIKATSKTSLR

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAAGTTAGGTTGAGCGTCTTTTAGTAATACAGAATTTGCTCAAGA
TATCTTTATAAAGTTTGCCAATCAATTCTATAAACAAGATGATGCTGGAA
CAATTTTATTTGAACTAAAAAAAACATTAGGAGTTAATCAACTAGATGAA
ATTGAAAAAAATAAAAAAGTTATTATTGTTAATCAGTTTCAAAATAGCTT
AGGCAAATTTTTACTTTTTAATAAAGAAAATACTAAAAGAATAAACAGTT
TAGCTAATGAACATATAAGTTCTTTTTTAAAAAAAATTTTCAGATTATCT
GGATTTAAAGATATGTTGATTGATGTTCAACATCATAAAAAGTTACAAAA
ATGTTTATTAAGAGAAATTCATCTTTTAGTTTGTTTAATTAATAGCAATC
AATTTAGTGATGAATTAATGCAAATTATTGAGTGGTATCAGTATTTAAAA
AAACACTCTAGTAAACTTTTTGTTATTACTGCAAGTAGTGATAAAAAACC
AGTAATAGAGCCAACTATAAATGAATATAAAGCTATTTTTGGAGAGTATT
TATCTTCATTTCACCTAGATCTAAAAAATAATCAAAGTAATGATTTATTC
CAGAAATTACTTGATCAGATCAAAATAAAAGCTACCTCAAAAACTAGTTT
GAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy