Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR285 IGR280 IGR281 IGR283 IGR282 IGR284 MG376 MG384.1 MG377 MG385 obg, - MG384 argS, - MG378 thrS, - MG375 udk, - MG382 MG381 gidA, - MG379 MG376 MG384.1 MG377 MG385 obg, - MG384 argS, - MG378 thrS, - MG375 udk, - MG382 MG381 gidA, - MG379 Type: tandem, Name:  - 18 Type: inverted, Name:  - 63 MG377 MG385 obg, - MG384 argS, - MG378 thrS, - MG375 outB, - MG383 outB, - MG383 MG376 MG384.1 udk, - MG382 MG381 gidA, - MG379 gidB, - MG380 gidB, - MG380
* Calculated from Protein Sequence

Gene ID: MG380

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gidB  

Definition:
glucose inhibited division protein B

Gene Start:
478999

Gene Stop:
479574

Gene Length:
576

Molecular Weight*:
22156

pI*:
10.34

Net Charge*:
12.10

EC:
 

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to glucose inhibited division protein B
sequences, e.g. residues 1-191 are 52% similar to GIDB_MYCPN.
MG380 shows very low similarity to T.pallidum TP0946, a predicted
glucose-inhibited division protein B sequence. It shows
no significant similarities to C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0357 is ehgpc--.
COG name: Predicted S-adenosylmethionine-dependent methyltransferase involvd in cell division.
Functional Class: M
BeTs to h,g,c.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 6-120, 121-192 constitute defined domains of GIDB_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 2 to 185 (E-value = 6e-78) place MG380 in the GidB family which is described as Glucose inhibited division protein (PF02527)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
192

PDB Hit:


Gene Protein Sequence:
MNNANFEKYVDLVFEANKNFNLTGFKTKEAIYQNLVIEILTLFKGYEKFF
IDKTVADLGSGNGSPGIILKLLFQKIKKLVLIDSKHKKISFLNKLTKQLN
LEKTVAICERIEVHKNHYDVICSRGLSTIIKVNDLAFSLLNSKGIIFHIK
QSLDQYIEFEKSNQKNQFNLLFIKHFTSQNKKLILIALQKND

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATAATGCTAATTTTGAAAAATATGTTGATTTAGTTTTTGAAGCAAA
CAAAAATTTCAACTTAACAGGATTTAAAACAAAAGAAGCTATTTATCAGA
ATTTAGTTATAGAAATATTGACATTATTTAAAGGATATGAAAAATTTTTT
ATTGACAAAACTGTAGCAGACTTGGGAAGTGGAAATGGTTCGCCTGGGAT
AATATTAAAACTGTTATTTCAAAAAATAAAAAAGTTAGTTTTAATTGATA
GTAAACACAAAAAAATTAGCTTTTTAAATAAATTAACTAAGCAACTAAAT
CTGGAGAAAACTGTTGCAATTTGTGAACGAATTGAAGTACATAAAAATCA
CTATGATGTTATCTGTTCTCGTGGTCTAAGTACGATTATTAAAGTTAATG
ATTTAGCATTTTCCTTGCTTAACTCAAAAGGTATTATTTTTCATATAAAA
CAAAGCTTAGACCAATACATTGAATTTGAAAAATCAAATCAGAAGAATCA
ATTTAACTTGTTATTTATAAAGCACTTTACTAGTCAGAATAAAAAACTAA
TTTTGATAGCTTTACAAAAAAATGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy