Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Arg-4 IGR285 IGR280 IGR279 IGR281 IGR283 IGR282 IGR284 MG376 MG377 outB, - MG383 MG373 argS, - MG378 thrS, - MG375 udk, - MG382 MG381 gidA, - MG379 MG376 MG377 outB, - MG383 MG373 argS, - MG378 thrS, - MG375 udk, - MG382 MG381 gidA, - MG379 Type: inverted, Name:  - 63 MG377 MG373 argS, - MG378 thrS, - MG375 MG374 MG374 MG376 udk, - MG382 MG381 gidA, - MG379 gidB, - MG380 gidB, - MG380
* Calculated from Protein Sequence

Gene ID: MG378

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
argS  

Definition:
arginyl-tRNA synthetase

Gene Start:
477139

Gene Stop:
475529

Gene Length:
1611

Molecular Weight*:
62396

pI*:
8.92

Net Charge*:
10.29

EC:
6.1.1.19  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Arginine and proline metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to arginyl-tRNA synthetase sequences,
e.g. residues 1-537 are 59% similar to SYR_MYCPN.
MG378 is similar to T.pallidum TP0831, a predicted
arginyl-tRNA synthetase. It shows no significant similarities
to C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0018 is ehgpcmy.
COG name: Arginyl-tRNA synthetase.
Functional Class: J
BeTs to h,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 113-123, 318-328, 363-372 are members of blocks
BL00178A,B(Aminoacyl-transfer RNA synthetases class-I proteins).
Residues 174-188 are matched to block BL00934D, concerned
with Glyoxalase I proteins, e.g. LGUL_YEAST.

ProDom Summary:  Protein Domain Search
Residues 1-104, 105-537 constitute defined domains of SYR_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 92 to 405 (E-value = 9.9e-172) place MG378 in the tRNA-synt_1d family which is described as tRNA synthetases class I (R) (PF00750)
Residues 420 to 537 (E-value = 2.2e-41) place MG378 in the tRNA-synt_1d_C family which is described as DALR anticodon binding domain (PF05746)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
32

PDB Hit:


Gene Protein Sequence:
MFFIINDLKECISALKLKFDDQKELVKLVKNNSFNGFSSTIIFQLKSENH
KKIADSIVEWFLKNKKDNYQNVFIANNNFINFQISYQKYLEYLIKTPCFT
KKNIKILIESVSANPTGRIHLGHVRIAFFGDVLNNLAKLLGYTTVCEYWV
NDYGQQARVFSFSVYQSLQLKKNIAIQQHPDGYSGIVIDKIASEIENFPV
DNLNFEEFCKTSFLDHFLVNCTQKVLSLIKSDLNKIHVFIDSWKFESEIV
KKTNFNDLLEQLKPNSYFYQDNALWLKTTLYGDDKDRVLIRSDKRASYFG
TDVAYHLEKLQRGFDILFNVWGTDHEGHIKRMYCAFDALKNTTKTSLKIF
ALQLVTLYKNKELVRLSKRAGNVITIETMLSMISEDAARWFMLSQNNGTI
IKIDLDIANLQNSANPVYYVQYAFARMNSILRIANSDQLKEITDCSLLIN
EKEISLLNQLVYYPFMLQKAMETGELHLLTNFLYETASLFHSWYKVCKIN
DDKNSLLSAQRLALLRSLQFIVKQILDVLKISTPQQM

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTTTATCATCAATGATTTAAAAGAATGCATTAGCGCTTTAAAGCT
TAAATTTGATGACCAAAAGGAACTTGTTAAACTAGTTAAAAATAATAGTT
TTAATGGTTTTTCTTCAACTATTATTTTCCAACTAAAAAGTGAAAATCAT
AAAAAAATTGCAGATAGTATTGTTGAGTGATTTTTAAAAAATAAAAAGGA
TAACTACCAAAATGTTTTTATTGCTAACAATAATTTTATAAACTTTCAAA
TTAGCTATCAAAAGTACTTAGAATACTTGATAAAAACACCTTGCTTTACT
AAGAAAAATATAAAGATTTTAATTGAATCTGTATCAGCAAATCCTACCGG
AAGGATCCATTTAGGTCATGTGAGAATAGCTTTTTTTGGTGATGTTTTAA
ACAATTTAGCCAAGCTGTTGGGTTATACAACAGTCTGTGAATATTGGGTA
AATGATTATGGACAACAAGCACGAGTTTTTAGCTTTAGTGTTTATCAAAG
TTTGCAGTTAAAAAAAAATATTGCTATCCAGCAACATCCTGATGGATATA
GTGGAATAGTAATAGATAAAATTGCTAGTGAAATTGAAAATTTTCCAGTT
GATAATTTAAATTTTGAAGAGTTTTGTAAAACATCATTCTTAGATCATTT
TTTAGTTAATTGCACCCAAAAAGTTTTGTCTTTAATTAAAAGTGATTTGA
ATAAAATCCATGTTTTTATTGATAGTTGAAAATTTGAAAGCGAAATTGTT
AAAAAAACAAATTTTAATGATCTTTTAGAACAACTTAAACCAAATAGTTA
TTTTTATCAAGATAATGCACTCTGACTAAAAACTACGCTTTATGGAGATG
ATAAGGATAGAGTTTTAATTAGAAGTGATAAAAGAGCTTCTTATTTTGGA
ACTGATGTTGCTTATCACTTAGAAAAATTACAACGTGGCTTTGACATTCT
ATTTAATGTTTGAGGCACTGATCATGAAGGACATATTAAAAGGATGTATT
GTGCATTTGATGCTTTAAAAAATACCACTAAAACTTCTTTAAAAATTTTT
GCATTACAACTGGTTACTCTCTATAAAAATAAAGAGCTAGTACGTTTGTC
AAAACGTGCTGGAAATGTAATCACAATTGAAACAATGCTTTCAATGATTA
GTGAAGATGCTGCTAGATGATTTATGTTATCTCAAAATAATGGCACAATT
ATCAAAATTGATTTAGATATAGCTAATTTGCAAAACTCTGCTAATCCAGT
TTATTATGTTCAATATGCGTTTGCAAGAATGAATAGTATTCTTAGAATTG
CAAATTCTGATCAATTAAAAGAAATTACTGATTGCAGTCTTTTGATTAAT
GAAAAAGAGATATCACTTTTAAATCAACTTGTCTATTATCCTTTTATGTT
GCAAAAAGCTATGGAAACAGGCGAATTGCACTTATTAACTAACTTTTTAT
ATGAAACTGCTAGTTTATTTCATTCCTGGTATAAAGTTTGCAAAATTAAT
GATGATAAAAATTCACTTTTATCAGCACAAAGACTTGCTTTATTGAGATC
ATTACAATTTATAGTTAAACAAATCCTTGATGTTTTGAAGATTTCAACAC
CACAACAAATG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy