Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR280 IGR279 IGR281 IGR283 IGR282 MG376 MG377 MG372 argS, - MG378 thrS, - MG375 MG381 gidA, - MG379 MG376 MG377 MG372 argS, - MG378 thrS, - MG375 MG381 gidA, - MG379 Type: inverted, Name:  - 63 MG377 MG372 argS, - MG378 thrS, - MG375 MG374 MG373 MG374 MG373 MG376 MG381 gidA, - MG379 gidB, - MG380 gidB, - MG380
* Calculated from Protein Sequence

Gene ID: MG377

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
475479

Gene Stop:
474901

Gene Length:
579

Molecular Weight*:
22634

pI*:
6.70

Net Charge*:
-0.79

EC:
 

Functional Class:
unknown; conserved hypothetical protein  

Pathway: pathway table

Comment:
Support for this annotation provided by Galperin and Koonin. 1998. Sources of systematic error in functional annotation of genomes: domain rearrangement, non-orthologous gene displacement, and operon disruption. In Silico Biology 1:55-67.

Blast Summary:  PSI-Blast Search
Single hit in gapped BLAST to Y377_MYCPN: residues 1-193
are 84% similar to this sequence.
MG377 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
None

Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 1-193 constitute a defined domain of Y377_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
144  
171

PDB Hit:


Gene Protein Sequence:
MATNLKSIAKLQKPIQYDKVIEVDRIFADPAFIEQHRQRILASFKDAKES
ALYHELTHIVIKDNLFSAAMNEIVSYFEFQINPEELKNVVEGLKRDVVKD
ADEKTIQSIAEKIIKKALVFNFLQKEWKVEVSDDIVKRVISLYYEKTNQN
VREYLDDKQKFEGIRTALIEERMVLETINHFKFHFNLTGQLPS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTACTAATCTTAAATCTATTGCAAAGTTGCAAAAACCTATTCAGTA
TGATAAGGTAATTGAAGTTGATCGTATTTTTGCAGATCCTGCTTTTATTG
AGCAACATCGGCAAAGAATTTTAGCTTCTTTTAAAGATGCTAAGGAAAGT
GCTCTTTACCACGAACTAACTCATATTGTTATTAAAGATAATTTGTTTTC
AGCAGCAATGAATGAAATTGTTAGTTATTTTGAATTTCAAATTAACCCTG
AAGAGTTAAAAAATGTTGTTGAAGGCTTGAAAAGAGATGTTGTTAAAGAT
GCTGATGAAAAAACAATTCAATCAATAGCTGAAAAAATCATTAAAAAAGC
TTTAGTATTTAATTTCTTACAAAAGGAATGAAAGGTTGAAGTTAGTGATG
ATATTGTTAAAAGAGTTATTAGCTTGTATTATGAAAAAACTAATCAGAAT
GTTAGAGAATATCTTGATGATAAACAAAAGTTTGAAGGTATTAGAACTGC
ATTAATAGAAGAAAGAATGGTTTTAGAAACAATTAACCACTTTAAATTTC
ATTTCAACTTAACAGGTCAATTACCTAGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy