Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR280 IGR279 IGR281 IGR283 IGR282 MG376 MG377 MG370 MG372 argS, - MG378 thrS, - MG375 gidA, - MG379 MG376 MG377 MG370 MG372 argS, - MG378 thrS, - MG375 gidA, - MG379 MG377 MG372 argS, - MG378 thrS, - MG375 MG374 MG373 MG371 MG374 MG373 MG371 MG370 MG376 gidA, - MG379
* Calculated from Protein Sequence

Gene ID: MG375

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
thrS  

Definition:
threonyl-tRNA synthetase

Gene Start:
474578

Gene Stop:
472887

Gene Length:
1692

Molecular Weight*:
65586

pI*:
10.18

Net Charge*:
25.07

EC:
6.1.1.3  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Glycine, serine and threonine metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
ThrS is also a translational repressor protein, it controls the
translation of its own gene by binding to its mRNA.

Reaction:
ATP + L-THREONINE + TRNA(THR) = AMP + PYROPHOSPHATE + L-THREONYL-TRNA(THR).

See Prosite PDOC00363.

From Prosite:

Aminoacyl-tRNA synthetases (EC 6.1.1.-) [1] are a group of enzymes which activate amino acids and transfer them to specific tRNA molecules as the first step in protein biosynthesis. In prokaryotic organisms there are at least twenty different types of aminoacyl-tRNA synthetases, one for each different amino acid. In eukaryotes there are generally two aminoacyl-tRNA synthetases for each different amino acid: one cytosolic form and a mitochondrial form. While all these enzymes have a common function, they are widely diverse in terms of subunit size and of quaternary structure.

The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine are referred to as class-II synthetases [2 to 6] and probably have a common folding pattern in their catalytic domain for the binding of ATP and amino acid which is different to the Rossmann fold observed for the class I synthetases [7].

[ 1] Schimmel P.
Annu. Rev. Biochem. 56:125-158(1987).
[ 2] Delarue M., Moras D.
BioEssays 15:675-687(1993).
[ 3] Schimmel P.
Trends Biochem. Sci. 16:1-3(1991).
[ 4] Nagel G.M., Doolittle R.F.
Proc. Natl. Acad. Sci. U.S.A. 88:8121-8125(1991).
[ 5] Cusack S., Haertlein M., Leberman R.
Nucleic Acids Res. 19:3489-3498(1991).
[ 6] Cusack S.
Biochimie 75:1077-1081(1993).
[ 7] Cusack S., Berthet-Colominas C., Haertlein M., Nassar N., Leberman R.
Nature 347:249-255(1990).
[ 8] Leveque F., Plateau P., Dessen P., Blanquet S.
Nucleic Acids Res. 18:305-312(1990).


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to threonyl-tRNA synthetase sequences,
e.g. residues 1-564 are 63% similar to SYT_MYCPN.
MG375 is similar to T.pallidum TP0837, a predicted
threonyl-tRNA synthetase sequence. It is also similar to
C.trachomatis threonyl-tRNA synthetase 2 sequence CT581.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0441 is ehgpcmy.
COG name: Threonyl-tRNA synthetase.
Functional Class: J
BeTs to g,c,m,y.

Blocks Summary:  Blocks Search
None

ProDom Summary:  Protein Domain Search
Residues 1-120, 121-172, 182-250, 251-275, 276-326, 338-480,
496-528 constitute defined domains of SYT_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 187 to 341 (E-value = 2.3e-31) place MG375 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 471 to 563 (E-value = 1.2e-26) place MG375 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
46  
80
non-globular  
82  
123
coil-coil  
139  
177
non-globular  
372  
564

PDB Hit:


Gene Protein Sequence:
MLAGVLLLQIWLKCKYANVQFGEHGFNGDEFYLDFYINENFSTKQFAKIE
SDLNSLSSKLEGISQKFVSLDEALSFFENDQFTKNLLKKSNLNKFKITFF
ENKHFWIEDLTLTFIKKSFIKLLNVSVNYFLGDPSQLQLQRINGIFAQSK
KELEQLIKENEERLKKDHRSLGKQLELFSFDPLIGAGLPIWLAKGTTLRN
IIGNFVHHQQLLFGFNTVCSPVLANIELFKISGHYQHYKEDMFPAIKLDS
QAMMLRPMTCPHHCLIFKQKRYSYKKMPQRFSEDSILHRFEASGGLIGLE
RVRCMTLLDNHIFCRADQIKSEIKNAFNLIQKVNKKFGFIFDRIDLSLHD
PKNQSKFIDNPGLWRESESQMENVLKDLNIQYQKEIGAAAFYGPKIDFQF
KTIFKKMITIATIQLDFLLPEKFDLTYIDKKNTLKKPVIIHVGIIGTYER
FIAALLEKTSGNFPLWLAPVQAVIIPVNIQKHLKAAKKLYNKLLKENIRV
NLDDNQDRLAKKVRQAIIEKIPLQLIVGDKEIENLEKLTCRGFKGEKITR
ISFNNFVKRVRRDG

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTGCAGGAGTTCTTTTATTACAAATATGGTTAAAATGCAAATATGC
TAATGTTCAGTTTGGTGAACATGGTTTTAATGGAGATGAATTTTATTTAG
ATTTTTATATAAATGAGAATTTTTCTACAAAACAGTTTGCAAAAATAGAA
TCTGATTTAAACTCTCTTTCTAGTAAACTAGAAGGGATTTCTCAAAAATT
TGTTTCTTTAGATGAAGCATTAAGTTTTTTTGAAAATGATCAGTTTACAA
AAAACTTATTAAAAAAAAGCAACTTAAACAAATTTAAAATCACCTTTTTT
GAAAATAAACATTTTTGAATAGAAGATTTAACTTTAACTTTTATTAAAAA
AAGTTTTATTAAGCTATTAAATGTAAGCGTAAATTATTTTTTGGGAGATC
CTTCACAATTACAACTTCAGAGGATTAATGGCATTTTTGCTCAATCAAAA
AAAGAATTAGAACAATTAATAAAAGAAAATGAAGAACGCTTGAAGAAGGA
TCACAGATCTTTAGGTAAACAATTAGAGTTATTTAGCTTTGACCCACTGA
TCGGTGCAGGTCTTCCTATTTGATTAGCAAAGGGTACAACACTAAGGAAT
ATAATCGGTAATTTTGTGCATCACCAGCAACTATTGTTTGGTTTTAATAC
TGTTTGTTCTCCTGTATTAGCTAACATAGAGCTTTTTAAAATTAGCGGCC
ACTATCAGCACTATAAGGAAGATATGTTTCCTGCTATTAAACTTGATAGT
CAAGCAATGATGCTTCGTCCTATGACATGTCCTCATCACTGTCTGATTTT
CAAACAAAAACGATATTCATATAAAAAAATGCCACAGCGCTTTTCAGAAG
ATTCTATTTTGCATCGTTTTGAAGCCTCTGGAGGATTAATAGGATTAGAA
AGAGTGAGGTGCATGACTTTACTTGATAATCACATTTTTTGTCGTGCAGA
TCAAATTAAAAGTGAGATTAAAAACGCATTTAATTTAATTCAAAAAGTTA
ATAAAAAATTTGGATTTATATTTGATAGGATAGATCTTTCTCTACATGAT
CCTAAAAATCAATCAAAATTTATTGATAATCCTGGTTTATGAAGAGAATC
TGAAAGCCAAATGGAGAATGTTTTAAAAGATTTAAATATCCAATATCAAA
AAGAGATAGGAGCTGCTGCTTTTTATGGACCAAAAATTGATTTTCAGTTC
AAAACAATCTTTAAAAAAATGATTACTATTGCCACCATTCAACTAGATTT
TTTACTACCAGAAAAATTTGATCTAACTTATATAGATAAAAAAAATACAC
TAAAAAAACCAGTTATTATCCATGTTGGAATTATTGGAACTTATGAAAGG
TTTATTGCTGCTTTACTTGAAAAAACAAGTGGTAATTTTCCTTTATGGTT
AGCACCTGTTCAAGCCGTAATTATTCCTGTTAATATCCAAAAGCATTTAA
AGGCAGCAAAAAAACTTTATAACAAATTGCTAAAAGAAAACATCCGTGTA
AATTTAGATGATAATCAAGATCGCTTAGCTAAAAAAGTTAGACAAGCAAT
CATTGAAAAAATTCCTTTACAACTTATTGTTGGAGATAAAGAAATAGAGA
ATTTAGAGAAGTTGACATGCCGTGGTTTTAAAGGTGAAAAAATCACCAGA
ATTAGCTTTAATAATTTTGTTAAAAGAGTTAGAAGAGATGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy