Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR277 IGR275 IGR273 IGR272 IGR276 IGR278 rpsT, - MG363.1 MG371 plsX, - MG368 MG369 rpL32, - MG363 rplL7/12,rplL, - MG362 rpL10, - MG361 fmt, - MG365 MG366 rpsT, - MG363.1 MG371 plsX, - MG368 MG369 rpL32, - MG363 rplL7/12,rplL, - MG362 rpL10, - MG361 fmt, - MG365 MG366 Type: inverted, Name:  - 58 rpsT, - MG363.1 MG371 plsX, - MG368 MG369 rnc, - MG367 MG370 rnc, - MG367 MG370 rpL10, - MG361 fmt, - MG365 MG366 MG364 MG364 rplL7/12,rplL, - MG362 rpL32, - MG363
* Calculated from Protein Sequence

Gene ID: MG367

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rnc  

Definition:
ribonuclease III protein

Gene Start:
465434

Gene Stop:
464649

Gene Length:
786

Molecular Weight*:
30324

pI*:
6.97

Net Charge*:
-0.06

EC:
3.1.26.3  

Functional Class:
Transcription; RNA degradation  

Pathway: pathway table
Miscellaneous enzymes

Comment:
See Prosite PDOC00448.

From Prosite:

Prokaryotic ribonuclease III (EC 3.1.26.3) (gene rnc) is an enzyme that digests double-stranded RNA. It is involved in the processing of ribosomal RNA precursors and of some mRNAs.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ribonuclease III protein sequences,
e.g. residues 13-261 are 71% similar to RNC_MYCPN.
MG367 is similar to T.pallidum TP0809, a predicted ribonuclease III.
It is also similar to C.trachomatis ribonuclease III sequence,
CT297.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0571 is ehgpc-y.
COG name: dsRNA-specific ribonuclease.
Functional Class: K
BeTs to h,g,c,y.

Blocks Summary:  Blocks Search
Residues 37-43, 55-66, 126-139, 171-177 are members of blocks
BL00517A-D(Ribonuclease III family proteins).

ProDom Summary:  Protein Domain Search
Residues 40-99, 126-156, 157-262 constitute defined domains
of RNC_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 56 to 141 (E-value = 5.7e-36) place MG367 in the Ribonuclease_3 family which is described as RNase3 domain (PF00636)

PDB Hit:


Gene Protein Sequence:
MKNKVLKLKNNKIFDKKLATFLKNLDIFPNNWEFFEKAFIHASYINEHED
VSESYDRLEFLGDALIDFVVAKKLFELYPKYNEGLLTRTKIEIVKGENLN
RIGMELKLGDFVKLSNGAELTENTVGDVLEALVGAIYEDMGMKKATEFVE
KYIFERTFSEILKYDFFSLFQEQKLPEPRVRVSLTSNNLVLSIIELDGDI
IWSQAIPNNKNYDDKSVLEHNAMASFTSFLKSSKGSHFFSDLKEKIENQK
MCKKLAIKPKKN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGAATAAAGTTTTGAAACTAAAAAATAATAAGATTTTTGATAAAAA
ACTAGCAACTTTTTTAAAGAATTTAGATATTTTTCCTAATAATTGAGAAT
TTTTTGAAAAAGCTTTTATTCACGCTTCTTACATCAATGAACATGAAGAT
GTTAGTGAAAGTTACGATCGCTTAGAGTTTTTAGGTGATGCTTTAATTGA
CTTTGTTGTTGCTAAAAAACTATTTGAACTTTATCCTAAATATAACGAAG
GTCTTTTAACAAGAACTAAGATTGAAATTGTTAAGGGTGAAAATCTTAAT
CGTATTGGTATGGAGCTAAAATTAGGTGATTTTGTTAAGTTAAGCAATGG
TGCTGAACTAACTGAAAACACTGTTGGTGATGTACTTGAAGCTTTGGTTG
GCGCCATTTATGAAGATATGGGGATGAAAAAAGCAACTGAATTTGTTGAA
AAATATATTTTTGAAAGAACTTTTTCTGAGATTTTAAAATACGATTTCTT
TTCACTTTTTCAAGAGCAAAAATTACCTGAACCAAGAGTTAGGGTAAGCT
TAACTTCAAATAATTTGGTACTTAGTATAATTGAACTTGATGGTGATATT
ATTTGATCACAAGCTATCCCAAATAACAAAAATTACGATGATAAAAGTGT
TTTAGAGCACAACGCAATGGCTTCTTTTACAAGTTTTTTAAAAAGTAGTA
AAGGAAGCCATTTTTTTAGTGATTTAAAAGAGAAGATAGAAAATCAAAAG
ATGTGTAAGAAACTAGCTATTAAACCTAAAAAAAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy