Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR275 IGR273 IGR269 IGR272 IGR271 IGR268 IGR270 rpsT, - MG363.1 MG356 ackA, - MG357 MG360 rpL32, - MG363 rplL7/12,rplL, - MG362 rpL10, - MG361 ruvB, - MG359 fmt, - MG365 MG366 rpsT, - MG363.1 MG356 ackA, - MG357 MG360 rpL32, - MG363 rplL7/12,rplL, - MG362 rpL10, - MG361 ruvB, - MG359 fmt, - MG365 MG366 rpsT, - MG363.1 MG356 ackA, - MG357 MG360 rpL32, - MG363 rpL10, - MG361 ruvB, - MG359 fmt, - MG365 MG366 MG364 ruvA, - MG358 MG364 ruvA, - MG358 rplL7/12,rplL, - MG362
* Calculated from Protein Sequence

Gene ID: MG360

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (probable DNA repair protein Rev1)

Gene Start:
459495

Gene Stop:
458263

Gene Length:
1233

Molecular Weight*:
47454

pI*:
10.28

Net Charge*:
20.93

EC:
2.7.7.-  

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypothetical proteins and to DNA repair
protein REV1 and to UV protection sequences, e.g. residues 1-409
are 59% similar to Y360_MYCPN.
MG360 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0389 is e-gpc-y.
COG name: DNA repair enzyme.
Functional Class: L
BeTs to e,g,y.

Blocks Summary:  Blocks Search
NONE.

ProDom Summary:  Protein Domain Search
Residues 37-217 constitute defined domains of Y360_MYCGE.
Residues 13-232 are 27% similar to a DNA repair protein REV1
domain represented by REV1_YEAST.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 23 to 358 (E-value = 3.6e-129) place MG360 in the IMS family which is described as impB/mucB/samB family (PF00817)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
96  
209
non-globular  
261  
411

PDB Hit:


Gene Protein Sequence:
MINTFTYFEPEYLIDKNLIFLYFDFDAFFASVEELENPELVNQPLIVGNR
FSRSVVSTCNYVARSYGIRSGMSILKALELCPNAIFAHSNFRNYRKHSKR
IFSVIESTFSLKIDVLSVDEGVACFQNISFKKAFLIAKKIKNFVFQNLRI
KISIGISDHFLIAKIFSNQAKPFGIKSCSVKDIKKKLWPLPITEIPGIGE
KHIDLVFKNNFYKINDLAVCEDASLLKKVFGNFWESLKAVSLGKWYTDNN
NQVKSRSFAVSETLEDLNYSNNQLNKKLTQIFDQLFIRLQLSSQVCKGIV
VQLKSNDFIVNSHSNKMKKYSNDYRKLLSITKRLFNRLLINTEKNVRLIG
ISFFDLKKIDTDEGQKKSLFYQFIPKSISKLSEESSLDKLIFDINESFGF
EIIKRANKLKS

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAACACCTTTACATATTTTGAACCAGAATATTTAATTGATAAAAA
TTTAATTTTTCTTTATTTTGATTTTGATGCTTTTTTTGCATCTGTTGAAG
AATTAGAAAATCCAGAATTAGTTAATCAACCCTTAATAGTTGGTAATCGC
TTTTCAAGAAGTGTAGTTTCAACTTGTAACTATGTTGCTCGTAGTTATGG
AATTAGATCTGGAATGTCTATTTTAAAAGCATTAGAACTATGTCCAAATG
CTATTTTTGCACATTCTAATTTTCGTAATTACAGAAAACATTCTAAACGT
ATTTTTTCAGTTATTGAAAGCACTTTTTCATTAAAAATTGATGTTCTTTC
TGTTGATGAAGGGGTTGCTTGTTTTCAAAACATTTCATTTAAAAAGGCAT
TTTTAATAGCGAAAAAAATAAAAAATTTTGTTTTTCAAAACTTGAGAATC
AAAATTTCAATTGGCATCTCAGATCATTTTTTAATTGCTAAGATTTTTTC
AAATCAAGCAAAACCATTTGGAATTAAAAGTTGTTCAGTTAAGGATATTA
AAAAAAAACTTTGACCACTACCAATTACTGAAATTCCAGGGATAGGAGAA
AAACATATTGATTTAGTTTTTAAAAATAATTTTTACAAAATAAATGATCT
AGCAGTTTGTGAAGATGCTTCGCTTTTAAAAAAAGTATTTGGTAATTTTT
GAGAATCTTTAAAAGCAGTTTCACTAGGCAAATGATATACAGATAATAAC
AATCAGGTTAAGTCTCGCTCTTTTGCAGTCAGTGAAACGTTAGAAGATTT
AAATTATTCAAACAATCAGTTAAATAAAAAGTTAACGCAAATATTTGATC
AGCTCTTTATAAGATTACAACTCTCTTCACAAGTGTGTAAAGGGATAGTT
GTGCAATTGAAAAGCAATGATTTTATTGTTAATTCTCATTCAAATAAAAT
GAAAAAATATTCAAACGATTATAGAAAACTACTGTCAATAACAAAACGAT
TATTCAACAGACTATTAATTAATACTGAAAAGAACGTTCGATTAATAGGT
ATTAGTTTTTTTGATTTAAAAAAGATAGATACAGATGAAGGACAGAAAAA
ATCTTTATTTTATCAATTCATACCAAAATCAATTAGCAAATTAAGCGAAG
AATCTTCACTTGATAAATTAATTTTTGATATTAATGAAAGTTTTGGTTTT
GAAATTATTAAAAGAGCTAATAAGCTTAAAAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy