Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Leu-4 tRNA-Leu-3 IGR262 IGR265 IGR264 IGR267 IGR269 IGR263.1 IGR266 IGR268 IGR260 IGR263 IGR261 MG353 MG350.1 MG356 MG348 ackA, - MG357 clpB, - MG355 MG354 MG352 ppa, - MG351 MG347 MG350 MG349 MG353 MG350.1 MG356 MG348 ackA, - MG357 clpB, - MG355 MG354 MG352 ppa, - MG351 MG347 MG350 MG349 Type: inverted, Name:  - 56 MG353 MG350.1 MG348 ackA, - MG357 clpB, - MG355 MG356 MG354 MG352 ppa, - MG351 MG347 MG350 MG349
* Calculated from Protein Sequence

Gene ID: MG351

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ppa  

Definition:
inorganic pyrophosphatase

Gene Start:
449665

Gene Stop:
450216

Gene Length:
552

Molecular Weight*:
21631

pI*:
5.76

Net Charge*:
-3.22

EC:
3.6.1.1  

Functional Class:
Central intermediary metabolism; Phosphorus compounds  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
Inorganic pyrophosphatase is the enzyme responsible for the hydrolysis of pyrophosphate (PPi).

See Prosite PDOC00325.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to inorganic pyrophosphatase sequences,
e.g. residues 1-184 are 82% similar to IPYR_MYCPN.
MG351 is similar to C.trachomatis Inorganic pyrophosphatase
sequence CT772. It shows no significant similarities to
T.pallidum sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0221 is ehgpc-y.
COG name: Inorganic pyrophosphatase.
Functional Class: C
BeTs to e,g,c,y.

Blocks Summary:  Blocks Search
Residues 9-21, 41-51, 55-64, 71-102, 103-130 are members of
blocks BL00387A-E(Inorganic pyrophosphatase proteins).

ProDom Summary:  Protein Domain Search
Residues 6-52, 53-114, 115-158, 159-184 constitute defined
domains of IPYR_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 7 to 161 (E-value = 8.3e-31) place MG351 in the Pyrophosphatase family which is described as Inorganic pyrophosphatase (PF00719)

PDB Hit:
gi|1311189|pdb|2PRD| Mol_id: 1; Molecule: Pyrophosphate Phosphohydrolase; Chain: Null; Ec: 3.6.1.1

Gene Protein Sequence:
MDKFLIDVIVEIPKNSKIKYEYDRQTGQIRVDRILFGSESYPQNYGFIKN
TLDWDGDELDCFIFADQPFLPATVVPTRIVGALEMIDDGEIDTKLLGVID
CDPRYKEINQISDLPKHRIEEILIFLKTYKLLQKKTVIIKGLKDVCWAKK
EYEICLQLMKDYGHLSKDQFIQKMQILHPEHYQK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACAAATTTTTAATTGATGTTATTGTAGAAATCCCTAAAAACAGCAA
AATAAAGTATGAGTATGATCGTCAAACTGGTCAAATTCGCGTTGATAGAA
TCCTATTTGGAAGTGAATCATATCCACAAAACTACGGTTTTATTAAAAAT
ACATTAGATTGAGATGGGGATGAACTTGATTGTTTTATCTTTGCAGATCA
ACCATTTTTGCCTGCAACAGTTGTGCCTACAAGAATTGTAGGAGCACTTG
AGATGATTGATGATGGGGAAATTGATACTAAGTTATTAGGAGTTATTGAT
TGTGACCCTAGATATAAAGAAATTAATCAAATTAGTGATTTACCTAAACA
TAGAATAGAAGAAATTCTTATCTTTTTAAAAACTTATAAATTACTTCAAA
AAAAGACTGTAATTATTAAGGGTTTAAAAGATGTTTGTTGAGCTAAAAAA
GAATATGAAATTTGTTTGCAATTAATGAAAGATTATGGTCATTTATCAAA
AGATCAATTTATCCAAAAAATGCAAATTCTTCATCCAGAACATTACCAAA
AG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy