Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 tRNA-Leu-3 IGR257 IGR258 IGR259 IGR256 IGR255 IGR260 IGR261 MG342 MG344 MG348 MG343 ileS, - MG345 rpoB, - MG341 MG347 MG349 MG342 MG344 MG348 MG343 ileS, - MG345 rpoB, - MG341 MG347 MG349 MG342 MG344 MG348 MG343 ileS, - MG345 rpoB, - MG341 MG347 MG349 MG346 MG346
* Calculated from Protein Sequence

Gene ID: MG345

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ileS  

Definition:
isoleucyl-tRNA synthetase

Gene Start:
443878

Gene Stop:
441194

Gene Length:
2685

Molecular Weight*:
104391

pI*:
10.06

Net Charge*:
41.82

EC:
6.1.1.5  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Valine, leucine and isoleucine biosynthesis
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
See Prosite PDOC00161.

From Prosite:

Aminoacyl-tRNA synthetases are a group of enzymes which activate amino acids and transfer them to specific tRNA molecules as the first step in protein biosynthesis. In prokaryotic organisms there are at least twenty different types of aminoacyl-tRNA synthetases, one for each different amino acid. In eukaryotes there are generally two aminoacyl-tRNA synthetases for each different amino acid: one cytosolic form and a mitochondrial form.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to isoleucyl-tRNA synthetase sequences,
e.g. residues 1-830 are 66% similar to SYI_MYCPN.
MG345 is similar to T.pallidum TP0452, TP1035, TP0644,
predicted isoleucyl, valyl and leucyl tRNA synthetases. It is
also similar to C.trachomatis isoleucyl, valyl and leucyl
tRNA synthetase sequences CT019, CT302 and CT209.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0060 is ehugpcmy.
COG name: Isoleucyl-tRNA synthetase.
Functional Class: J
BeTs to e,u,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 57-67, 588-597 are members of blocks BL00178A,B(Aminoacyl-transfer
RNA synthetases class-I proteins).
Residues 603-629, 699-721 are matched to blocks PR00247C,F,
concerned with CAMP-type GPCR proteins, e.g. CAR2_DICDI.

ProDom Summary:  Protein Domain Search
Residues 2-23, 64-187, 188-207, 249-271, 296-337, 361-395, 490-507,
557-573, 605-629, 658-762, 763-895 constitute defined domains of
SYI_MYCGE.
Residues 545-559 are 40% similar to a methionyl-tRNA synthetase
domain of SYM_BACSU.

Paralogs:  Local Blast Search
MG345 is paralogously related to MG334(valyl-tRNA synthetase)
and to MG266(leucyl-tRNA synthetase): residues 11-832 are 23%
similar to MG334 and residues 19-617 are 21% similar to MG266.
It is also weakly related to MG021(methionyl-tRNA synthetase):
residues 521-766 are 24% and residues 58-218 are 23% similar to MG021.

Pfam Summary:  Pfam Search
Residues 26 to 629 (E-value = 5.2e-171) place MG345 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)
Residues 866 to 894 (E-value = 2.4e-06) place MG345 in the zf-FPG_IleRS family which is described as Zinc finger found in FPG and IleRS (PF06827)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
410  
437
coil-coil  
787  
814
non-globular  
819  
895

PDB Hit:


Gene Protein Sequence:
MDLKKTLLMPKTSFAMQANLSTSEKNFHDFWKDKKVFQKLKKQNKGKQIK
ILHDGPPYANGSIHVGHALNKILKDFILRSWLYEGYDVVFIPGWDCHGLP
IEHAVSKKNPSSYSNLSTVEKRKLCHQFALSQIAVQKEQFQRLGLLNDFQ
NCYYTIDESFQFKELELFLQAIKKGLIFQDLKPTYWSPISRTSLAEAEIE
YKEVNSIALYLTFKVSKSDFLDENANLLVWTTTPWTLPTNQAIAIHPDFD
YLLFEYNQQKFVILEKLFEVFTNKLNWTNAIKLKKFKGSNLKNSSYSHCF
YNKVLPVLMGIHVVDNEGTGIVHSSPAFGIDDFYLCQKNKIKEVLISIDE
KGVFNNLLNDKELENCFYLKANDLIINRLKQNNSFIFSEVISHREPHDWR
SKTPVIYRASKQLFIKTKSIKKQLKKQINQVNFLNSKNQLRLKEMLLQRD
EWCISRQRVWGLPIPIVYANNKPLLDFSTIQYTIKQLKKHGIDSWFEKDV
TCFLKPDKTKKWVKYHKEIDTLDVWFDSGSSYNVLEINKYGSIADLYIEG
SDQYRGWFNSSSNCGIIQNDLIPFKSLVSHGFTLDENGNKMSKSLGNIVD
PLKICDQYGADILRLWVANTDWQIDNKIGVNILKQVAEQYRRIRNSLLRF
ILGNINGFNFTSMDDYKFSLEDKIVIHKTNSLVEQIEKFLEKYNFLGCLK
VINKFVLWLSSWYFEIIKDTLYCDAKNNPNRLAKQAVLNYIFTQLISFLN
IFIPHTAEDAWKNYSFNKKPISVNLFTKPTVFKVANSKNLGNIYKTFTSI
KNAAFKEIEKLRKEGLISKNNQIELTVGINKKIPKKLKDNLALWLNVNSV
NLTNNENEIKVKKTKKTMCERCWNFQTIIKQKLDHNLCSRCFKVC

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACTTAAAAAAGACATTGTTAATGCCTAAAACATCCTTTGCGATGCA
GGCAAATTTATCTACTAGTGAAAAGAATTTTCATGATTTTTGAAAAGATA
AAAAAGTCTTTCAAAAATTAAAAAAACAGAATAAAGGAAAACAGATAAAA
ATACTGCATGATGGACCACCTTATGCAAATGGTAGTATTCATGTGGGACA
TGCTCTTAACAAGATTTTAAAAGACTTCATTTTACGTAGTTGGTTATATG
AAGGATATGATGTTGTTTTTATTCCTGGTTGGGATTGTCATGGACTACCA
ATAGAACATGCAGTTAGTAAGAAAAACCCTAGTAGTTATAGCAATCTTTC
AACTGTTGAAAAAAGAAAATTATGTCATCAGTTTGCACTTTCACAAATTG
CAGTTCAAAAAGAACAATTTCAAAGACTGGGACTTTTAAATGATTTTCAA
AACTGTTATTACACAATAGATGAGAGTTTTCAATTTAAGGAACTTGAACT
ATTTTTACAAGCAATTAAAAAAGGGCTCATTTTTCAAGATTTAAAACCAA
CTTATTGATCACCAATTTCAAGAACTTCACTTGCTGAAGCGGAAATTGAA
TATAAAGAAGTTAATTCAATTGCACTTTATTTAACTTTTAAAGTTTCTAA
AAGTGATTTTTTAGATGAAAATGCTAATTTATTAGTTTGAACAACAACTC
CTTGAACACTACCAACTAATCAAGCAATTGCCATTCATCCTGATTTTGAT
TATCTTCTTTTTGAATATAACCAACAAAAATTTGTTATCTTGGAAAAATT
ATTTGAAGTTTTTACAAATAAGTTAAATTGAACAAATGCAATTAAACTAA
AAAAATTCAAGGGTTCAAATTTAAAAAATTCAAGCTATTCTCATTGTTTT
TATAACAAGGTTTTACCAGTTCTAATGGGAATACATGTTGTTGATAATGA
GGGAACAGGTATTGTTCACAGCTCCCCTGCATTTGGAATTGATGATTTTT
ATCTTTGTCAAAAAAACAAGATTAAAGAAGTTTTGATTTCTATTGATGAG
AAAGGTGTATTTAATAACTTACTTAATGATAAAGAACTTGAGAATTGTTT
TTATCTTAAAGCAAATGATCTAATTATTAATCGTTTAAAACAAAACAATA
GCTTTATTTTTTCTGAAGTTATTTCCCACCGCGAACCACATGATTGACGC
TCAAAAACTCCAGTTATATACCGTGCTTCCAAACAATTATTCATTAAAAC
TAAATCAATAAAAAAGCAGTTAAAAAAACAAATTAATCAAGTTAATTTTT
TAAATTCAAAAAATCAATTGAGATTAAAAGAGATGCTTTTACAACGTGAT
GAATGATGTATCTCACGTCAAAGAGTATGGGGCTTGCCTATACCAATTGT
TTATGCAAATAACAAACCATTGTTAGATTTTTCAACAATTCAATACACAA
TTAAACAATTGAAAAAGCATGGTATTGATAGTTGATTTGAAAAAGATGTA
ACTTGTTTTTTAAAACCTGATAAAACCAAAAAATGAGTTAAGTATCACAA
GGAGATTGATACATTAGATGTTTGATTTGACTCAGGTTCTTCCTATAATG
TTTTGGAAATAAATAAATATGGTTCAATAGCTGATCTTTATATTGAAGGT
TCTGATCAATATCGGGGTTGGTTCAACTCTTCTTCAAATTGCGGAATTAT
TCAAAATGATTTAATCCCTTTTAAATCACTTGTTTCACATGGTTTTACAC
TTGATGAAAATGGCAATAAAATGTCAAAGTCATTAGGAAACATAGTTGAT
CCTTTAAAAATTTGTGATCAATATGGAGCGGATATATTAAGGTTGTGAGT
TGCTAATACTGATTGACAAATTGATAACAAAATAGGTGTTAATATTCTTA
AACAAGTTGCTGAACAATACCGCAGAATTAGAAATAGTTTACTACGTTTT
ATTTTGGGTAATATTAATGGATTTAACTTTACATCAATGGATGATTATAA
GTTTTCACTAGAAGACAAAATAGTTATCCATAAAACTAATTCACTAGTAG
AACAAATTGAGAAATTTTTAGAGAAATATAATTTTTTAGGTTGCCTAAAA
GTGATTAATAAGTTTGTTTTATGACTATCAAGCTGATACTTTGAAATAAT
TAAAGACACCTTATATTGTGATGCTAAAAATAATCCTAATCGTTTAGCTA
AACAAGCTGTTTTAAACTATATTTTTACACAACTAATCAGTTTTTTAAAT
ATCTTTATTCCCCACACTGCAGAAGATGCTTGAAAAAACTATTCATTCAA
TAAAAAACCAATAAGTGTGAACCTCTTTACAAAACCGACTGTTTTTAAAG
TTGCTAACTCTAAGAATTTAGGAAATATCTATAAAACTTTTACTAGTATT
AAAAATGCTGCTTTCAAAGAAATTGAAAAGCTAAGAAAAGAAGGGTTGAT
TTCTAAAAATAATCAAATTGAATTAACCGTTGGAATTAATAAAAAAATAC
CCAAAAAATTAAAGGATAATCTCGCACTTTGACTTAATGTAAACAGTGTT
AATTTAACAAATAATGAAAATGAAATTAAAGTTAAAAAAACTAAAAAAAC
AATGTGTGAAAGATGCTGAAATTTTCAAACAATCATTAAGCAAAAATTAG
ATCATAATTTGTGCTCACGTTGTTTTAAAGTGTGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy