Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-His-1 IGR257 IGR258 IGR259 IGR256 IGR255 IGR260 MG342 MG344 MG348 MG343 ileS, - MG345 rpoB, - MG341 MG347 MG342 MG344 MG348 MG343 ileS, - MG345 rpoB, - MG341 MG347 MG342 MG344 MG348 MG343 ileS, - MG345 rpoB, - MG341 MG347 MG346 MG346
* Calculated from Protein Sequence

Gene ID: MG344

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
probable esterase/lipase 3

Gene Start:
441180

Gene Stop:
440362

Gene Length:
819

Molecular Weight*:
31790

pI*:
10.20

Net Charge*:
14.78

EC:
3.1.1.3  

Functional Class:
Fatty acid and phospholipid metabolism; Degradation  

Pathway: pathway table
Metabolism of Complex Lipids; Glycerolipid metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to predicted esterase/lipase sequences and
to triacylglycerol lipase sequences, e.g. residues 6-273 are
67% similar to ESL3_MYCPN. MG344 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0570 is ehugpc-y.
COG name: Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold.
Functional Class: R
BeTs to u,g,c.

Blocks Summary:  Blocks Search
NONE.

ProDom Summary:  Protein Domain Search
Residues 20-105 are 77% similar to a putative esterase/lipase 3
domain represented by ESL3_MYCPN.
Residues 31-123 are 35% similar to a putative esterase/lipase 2
domain represented by ESL2_MYCPN.
Residues 30-128 are 30% similar to a putative esterase/lipase 1
domain represented by ESL1_MYCPN.

Paralogs:  Local Blast Search
MG344 is paralogously related to MG327(magnesium-chelatase
30 kDa subunit): residues 19-268 are 24% similar to MG327.
It is also weakly related to MG310(proline iminopeptidase):
residues 30-262 are 19% similar to MG310.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
131  
273

PDB Hit:


Gene Protein Sequence:
VKRFSDLNQIDISKLEVFFQPAKKTKKQTVVFAHGFSVFHSYFQSFYKTL
TDYDYYAPLWPGHNVNGFDYKELSPIHYGELLAAFIENKDLENIVLIGHS
MGAAVCSYAMNLLNAKRVEKLILLAPLSYCNLLRYFKIKSSFKKDKAERM
ANFKAMFQTKFSNLTDENSWENELSKHSKMAKKLSNNILKELPVLNKTYK
NLKLPVFLVLAQNDLFMPTKLTLSYFNKYLIKNNNLQSSVILNSEHQMFN
SKYESFCKAMDDILNHNKLSKIY

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAAAGGTTTTCAGATCTTAATCAGATTGATATTTCTAAGCTTGAAGT
TTTCTTTCAGCCAGCAAAAAAAACAAAAAAACAAACGGTTGTTTTTGCAC
ATGGATTTTCTGTTTTTCATAGCTACTTTCAAAGTTTTTATAAAACCCTT
ACTGATTATGACTATTACGCTCCACTTTGACCTGGTCATAATGTAAATGG
TTTTGATTATAAGGAATTATCTCCAATCCATTATGGAGAACTATTAGCTG
CTTTTATAGAAAATAAGGATCTGGAAAACATCGTTCTAATAGGACACAGT
ATGGGTGCTGCTGTTTGTAGTTATGCCATGAATTTATTAAATGCTAAACG
TGTTGAAAAACTCATACTTTTAGCACCTCTTTCATACTGTAACTTATTGA
GATATTTCAAAATTAAAAGTTCTTTTAAAAAAGATAAGGCAGAAAGAATG
GCTAATTTTAAAGCAATGTTTCAAACTAAATTTAGTAATTTAACTGATGA
AAACAGCTGAGAAAATGAGCTGTCAAAACACAGTAAAATGGCTAAAAAGC
TTTCTAATAATATTTTGAAAGAACTACCAGTTTTAAATAAGACTTATAAA
AATTTAAAGTTACCAGTGTTTTTGGTTTTAGCTCAAAATGATTTATTTAT
GCCAACAAAATTAACATTAAGCTATTTCAATAAATACCTAATTAAGAACA
ATAATTTGCAATCATCTGTTATCTTAAACAGTGAACACCAAATGTTTAAT
AGTAAATATGAAAGCTTTTGTAAAGCAATGGATGATATCCTGAATCATAA
TAAACTAAGTAAAATTTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy