Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR257 IGR254 IGR258 IGR256 IGR255 MG342 MG344 MG343 ileS, - MG345 rpoC, - MG340 rpoB, - MG341 MG342 MG344 MG343 ileS, - MG345 rpoC, - MG340 rpoB, - MG341 MG342 MG344 MG343 ileS, - MG345 rpoC, - MG340 rpoB, - MG341
* Calculated from Protein Sequence

Gene ID: MG341

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpoB  

Definition:
DNA-directed RNA polymerase, beta subunit

Gene Start:
438640

Gene Stop:
434471

Gene Length:
4170

Molecular Weight*:
156334

pI*:
6.76

Net Charge*:
-2.95

EC:
2.7.7.6  

Functional Class:
Transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribnucleoside triphosphates as substrates.

Activity: N nucleoside triphosphate = N pyrophosphate + RNA(N).

Bacterial RNA polymerase consists of a sigma factor and a core enzyme composed of two alpha, one beta and one beta' chains.

Reference: Eur J Biochem. 1981 Jun 1;116(3):621-9.

See MG022, a predicted rpoE sequence; MG054, a predicted nusG sequence; MG141, a predicted nusA sequence; MG177, a predicted rpoA sequence; MG249, a predicted rpoD sequence; and MG340, a predicted rpoC sequence.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to DNA-dependent RNA polymerase beta subunit
sequences, e.g. residues 1-1372 are 84% similar to RPOB_MYCPN.
MG341 is similar to T.pallidum TP0241, a predicted
DNA-directed RNA polymerase, beta subunit. It is also similar to
C.trachomatis DNA-directed RNA polymerase, beta subunit
sequence CT315.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0085 is ehugpcmy.
COG name: DNA-dependent RNA polymerase beta subunit (split gene in MJ).
Functional Class: K
BeTs to h,u,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 141-1289 represent 7 matches to blocks BL01166A-G
(RNA polymerases beta chain proteins).
Residues 405-421, 859-877, 879-901 are matched to blocks
PR00546C,D,I, concerned with thyroid hormone receptor signature, e.g. THB1_HUMAN.

ProDom Summary:  Protein Domain Search
Residues 48-90, 81-99, 112-141, 166-376, 388-409, 429-479,
503-676, 701-828, 843-884, 885-1022, 1052-1106, 1141-1182,
1195-1211, 1239-1311, 1312-1346 constitute defined domains
of RPOB_MYCGE. Residues 891-955, 142-249, 1168-1199 support
this assignment, e.g. RPOB_SYNY3, RPOB_SPICI.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 32 to 606 (E-value = 1.3e-23) place MG341 in the RNA_pol_Rpb2_1 family which is described as RNA polymerase beta subunit (PF04563)
Residues 607 to 679 (E-value = 1.1e-40) place MG341 in the RNA_pol_Rpb2_3 family which is described as RNA polymerase Rpb2, domain 3 (PF04565)
Residues 814 to 1279 (E-value = 2.3e-233) place MG341 in the RNA_pol_Rpb2_6 family which is described as RNA polymerase Rpb2, domain 6 (PF00562)
Residues 1281 to 1357 (E-value = 4.3e-49) place MG341 in the RNA_pol_Rpb2_7 family which is described as RNA polymerase Rpb2, domain 7 (PF04560)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
271  
360
coil-coil  
413  
441
coil-coil  
1142  
1174

PDB Hit:


Gene Protein Sequence:
MSQKSNFFQKRYSPTATRRYYGKIETNFIQPNLADIQIKSYQKFLDHDLE
KLIASYFPIKSPNDRYTINFRGLHRTEPERDEAQSRAQSKTYEVGIYADL
ELVDNDKGTVKKARKSKKNIASNTNGVFLASMPLITHDGVFIINGIEKFV
ISQITRSPGIYMLTKSQLKLSNSRKRVQEGYVCEVLPANGSVMLIYISNK
KKIEDAFVQILLRDAVREGAKIFPITTLLKAFGLNNREILKIFKNNEFIK
RSLEAEIYNAKDFLSNVDPEIKNLLKEFRDGKTDLRRKGIASDQKLRSLV
NEYVTLEKQYNALKQTSPNDSSLTALELEMENKMDSVITERAAKHIVNEL
SISLRDIENTEECHEVSFHALLCARFFRNKRYNLSNAGRYKVSRKLRLTE
RIYQKTLACDLFLKDGKLLLKKGTLLLKEEIDKIKQAAKNNEISFVNKMQ
LTTDGKAVDLAKESLFYETIDVYITNDNLSVSVPVIGIHNENDLNKAMTL
SDFIASISYVINLPYGIGKYDDIDHLGNKRVKLINELITAKLESGFTRME
RFLKEKLTIADGVNRGQQINEEGQVIEQGEKKELTIKSLINSKPIQIVIK
DFFNTHQLTQFLDHQNPLSELSNKRRISAMGPGGISREDPNLDIRDVHYS
QYGRICPIETPEGMNIGLIMSLASFAKIDENGFLMAPYRKIKAGVITDEV
EYLTALREDEHIIAEISSLVNISNDNKILDKEIIGRYRSMQGLYDPLKID
YIDVAPHQVVSIGSSLIPFLENDDSARALMGTNMQRQAYPLIKPYAPAVG
TGQEHKIASDSGLTMSSPCSGVVSYVDNSKIIITSDSSKKETVNLVKFER
SNQNTCYNHKPIVEIGQRVNKDEIIVDGPAVNKSELALGQNVLVAFTTWN
GYNYEDAIVISERLVKEDILTSLTINEYVAQCLSTKNGDEQITRDIPNVS
DANKRYLDENGIIMVGAEVKEGDVLVGKVSPKGQVEVSPEEKLFKAIFPE
SVQNVRDSSLKVSHGGDGIVSAVKRFSIANGDELNDGVIEMIKVYVVQKR
KIQIGDKLAGRHGNKGVISKVVPIEDMPHLEDGTPVDILLNPLGVPSRMN
IGQIFETHLGYAAHKLAVRSLISSCFDQNKAKEFAIEINQPQARVERLIK
GLKNQINDRNIKSEKEALEKLDNSDISLVLKEIGMSFDDLIYKIATPIFQ
GVNFLDLQDVMQEAGLDPQKNQGKFKLIDGRSGMPFERPISLGIMYMMKL
NHMVDDKIHARAVGPYSKITQQPLGGKSQNGGQRFGEMEVWALEAYGAAY
NLQELLTIKSDDVQGRNRAYAAIVKGAAFPEPGIPESFKLLTKELQGLAL
SVSFIYDDNTQQDSNNVSILQSDGEQDEFFNDFEFDTEGY

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCACAAAAATCTAATTTCTTTCAAAAACGTTATTCCCCTACAGCTAC
CAGAAGGTATTATGGCAAAATTGAGACCAATTTTATCCAACCAAATTTAG
CTGATATTCAGATTAAAAGCTACCAAAAATTCTTAGATCATGATCTTGAA
AAATTAATTGCCTCATATTTTCCAATCAAATCCCCTAATGATCGCTACAC
TATCAATTTTAGGGGATTACACAGAACTGAACCAGAACGTGATGAAGCAC
AATCACGTGCTCAATCTAAAACTTATGAAGTTGGTATTTATGCTGATCTT
GAATTAGTTGATAATGATAAAGGAACAGTTAAAAAAGCACGGAAATCAAA
GAAAAATATTGCTAGCAATACAAATGGTGTATTTTTAGCTAGCATGCCTT
TAATAACCCATGATGGGGTTTTTATTATCAATGGGATAGAAAAGTTTGTT
ATTTCCCAAATAACCCGTTCTCCAGGGATATACATGCTAACAAAATCCCA
ACTAAAACTATCCAACTCCCGTAAAAGAGTACAGGAAGGTTATGTTTGTG
AGGTTTTACCTGCTAATGGTTCAGTGATGCTTATATACATCTCCAATAAA
AAAAAGATTGAAGATGCTTTTGTACAAATTCTTTTAAGAGATGCGGTAAG
AGAAGGTGCTAAGATTTTCCCTATTACAACACTTTTAAAAGCGTTTGGTT
TAAATAATCGTGAGATCCTTAAAATCTTTAAAAACAATGAATTTATCAAA
CGTTCATTGGAAGCGGAAATTTACAATGCTAAGGATTTTTTAAGCAATGT
TGATCCTGAAATCAAAAACCTTTTAAAAGAATTTAGAGATGGTAAAACTG
ATTTAAGAAGAAAAGGGATCGCTTCTGATCAGAAATTAAGATCACTTGTT
AATGAATATGTAACGCTTGAGAAACAATATAATGCGCTAAAACAAACAAG
TCCAAATGATTCTAGTTTAACTGCACTTGAACTGGAAATGGAAAACAAAA
TGGATAGTGTTATTACTGAAAGAGCTGCTAAACACATTGTCAATGAACTT
TCTATTTCACTGCGTGATATTGAAAACACTGAAGAGTGTCATGAAGTGAG
TTTCCATGCACTTTTATGTGCGCGTTTTTTTAGAAACAAGAGGTACAACC
TCTCTAATGCAGGGAGATACAAAGTATCTAGAAAGTTACGTTTAACAGAA
CGTATTTATCAAAAAACTCTGGCATGTGATTTGTTCTTAAAAGATGGCAA
GCTACTTTTAAAAAAAGGTACTTTACTTTTAAAAGAAGAGATTGACAAAA
TCAAACAAGCTGCTAAGAACAATGAAATTAGTTTTGTTAATAAAATGCAA
CTTACAACTGATGGTAAGGCTGTTGATTTAGCAAAAGAATCACTCTTTTA
TGAAACGATAGATGTATATATCACTAATGATAATCTTAGTGTTTCAGTAC
CAGTTATAGGGATCCATAACGAAAATGATCTGAACAAAGCAATGACTCTC
AGTGATTTCATCGCTTCAATTAGTTATGTGATTAATTTACCTTATGGAAT
TGGTAAATATGATGATATTGATCACCTTGGTAATAAGCGGGTTAAGTTAA
TTAATGAATTAATTACTGCTAAATTAGAAAGCGGCTTCACTAGAATGGAG
CGCTTTTTAAAAGAAAAGTTAACTATTGCTGATGGAGTTAACCGTGGCCA
GCAAATTAATGAAGAGGGTCAGGTTATTGAACAAGGTGAAAAAAAGGAAT
TAACTATTAAATCTTTAATCAACTCAAAACCAATTCAAATTGTGATTAAA
GACTTCTTCAATACCCACCAATTAACCCAATTTTTAGACCACCAAAACCC
TTTATCAGAATTGAGTAATAAAAGAAGGATTTCAGCAATGGGACCTGGGG
GAATATCAAGAGAGGACCCTAATTTAGATATCCGTGATGTGCATTATTCT
CAGTACGGTAGAATTTGCCCTATTGAAACACCTGAAGGGATGAACATAGG
GTTGATCATGTCTTTAGCTAGCTTTGCTAAGATTGATGAAAACGGATTTT
TAATGGCACCTTATCGCAAAATCAAAGCTGGGGTAATTACTGATGAGGTG
GAATATTTAACTGCGCTTAGAGAAGATGAACATATTATTGCTGAGATCTC
TTCACTTGTCAATATTAGTAACGATAACAAGATCTTAGATAAGGAAATTA
TTGGTAGGTATCGATCTATGCAAGGACTTTATGATCCTTTAAAGATTGAT
TACATTGATGTAGCACCACACCAAGTTGTTTCCATTGGTTCTTCTTTAAT
CCCCTTTTTGGAAAATGATGATTCAGCTAGAGCATTAATGGGAACCAACA
TGCAACGTCAGGCCTATCCTTTAATAAAGCCATATGCTCCTGCAGTAGGT
ACTGGTCAAGAACACAAAATTGCTAGTGATTCAGGTTTAACAATGTCCTC
TCCTTGCTCAGGTGTTGTTAGTTATGTTGATAACAGTAAGATTATTATTA
CAAGTGATAGTTCTAAAAAAGAGACAGTTAACCTAGTTAAATTTGAACGT
TCCAACCAAAATACTTGTTATAACCACAAACCAATTGTTGAAATAGGCCA
AAGGGTTAATAAGGATGAAATCATTGTTGATGGCCCTGCTGTTAATAAGA
GTGAGTTGGCATTAGGACAGAATGTTTTAGTTGCTTTTACAACTTGAAAT
GGTTATAACTATGAAGATGCAATTGTCATTTCAGAACGATTAGTTAAGGA
AGATATTCTCACTTCATTAACCATTAATGAGTATGTTGCTCAATGTTTGT
CTACTAAAAATGGTGATGAACAAATTACCCGTGATATCCCTAATGTTAGT
GATGCAAACAAACGCTATCTTGATGAGAATGGCATCATTATGGTGGGTGC
TGAAGTTAAAGAAGGGGATGTTTTGGTTGGTAAAGTTTCCCCTAAAGGTC
AAGTCGAAGTCTCTCCTGAAGAAAAGCTATTTAAAGCCATCTTCCCTGAA
AGTGTTCAAAACGTGAGAGACTCTTCACTTAAAGTTTCCCATGGTGGGGA
TGGTATTGTTTCAGCTGTAAAACGTTTTTCAATTGCTAATGGTGATGAAC
TTAATGATGGTGTGATTGAAATGATCAAGGTTTATGTGGTTCAAAAACGT
AAGATTCAAATTGGTGATAAATTAGCTGGTAGACACGGAAATAAAGGAGT
TATTTCTAAAGTGGTGCCTATTGAAGATATGCCCCATTTAGAAGATGGAA
CCCCAGTTGATATTCTGCTCAACCCCCTTGGTGTTCCTAGTCGGATGAAC
ATAGGACAAATTTTTGAAACCCACTTGGGTTATGCAGCACACAAGCTAGC
AGTTCGTTCTTTAATTAGTAGTTGTTTTGATCAAAATAAAGCTAAGGAGT
TTGCCATTGAAATCAATCAACCTCAAGCAAGGGTTGAAAGATTAATTAAA
GGTTTAAAAAACCAAATCAATGATCGCAATATTAAAAGTGAAAAAGAAGC
ACTTGAAAAACTCGATAACAGTGACATTAGTTTAGTTTTGAAAGAGATAG
GGATGTCTTTTGATGATCTTATTTACAAAATTGCAACCCCTATTTTCCAA
GGAGTGAACTTCTTAGATCTCCAAGATGTTATGCAAGAAGCAGGATTAGA
TCCCCAAAAAAATCAGGGTAAGTTTAAACTCATTGATGGTAGGAGTGGAA
TGCCATTTGAAAGACCTATTTCACTTGGAATTATGTACATGATGAAGCTG
AATCACATGGTTGATGATAAGATCCATGCTCGTGCTGTTGGCCCTTATTC
TAAGATCACTCAACAACCATTAGGTGGTAAATCGCAAAATGGTGGACAGC
GGTTTGGTGAGATGGAAGTGTGAGCATTAGAAGCTTATGGAGCTGCTTAT
AACTTGCAAGAACTTTTAACCATTAAATCTGATGATGTACAAGGAAGAAA
TAGGGCTTATGCTGCTATTGTTAAAGGTGCAGCTTTCCCAGAGCCTGGTA
TCCCTGAATCATTTAAATTATTGACAAAAGAATTACAGGGCTTGGCTTTA
TCTGTTTCATTTATCTATGATGACAACACCCAACAAGACTCCAATAATGT
TTCCATCTTGCAAAGTGATGGGGAACAAGATGAATTTTTCAATGATTTTG
AATTTGACACTGAGGGTTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy