Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR254 IGR253 recA, - MG339 rpoC, - MG340 rpoB, - MG341 recA, - MG339 rpoC, - MG340 rpoB, - MG341 Type: direct, Name:  - 25 Type: direct, Name:  - 44 Type: tandem, Name:  - 17 Type: direct, Name:  - 37 Type: inverted, Name:  - 55 Type: inverted, Name:  - 54 Type: inverted, Name:  - 53 Type: direct, Name:  - 40 Type: tandem, Name:  - 16 Type: direct, Name:  - 35 Type: inverted, Name:  - 54 Type: inverted, Name:  - 55 Type: inverted, Name:  - 64 Type: inverted, Name:  - 60 Type: inverted, Name:  - 64 Type: tandem, Name:  - 15 Type: inverted, Name:  - 60 Type: direct, Name:  - 36 Type: inverted, Name:  - 62 Type: inverted, Name:  - 53 Type: inverted, Name:  - 61 Type: inverted, Name:  - 62 recA, - MG339 rpoC, - MG340 rpoB, - MG341
* Calculated from Protein Sequence

Gene ID: MG340

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpoC  

Definition:
DNA-directed RNA polymerase, subunit beta prime

Gene Start:
434458

Gene Stop:
430583

Gene Length:
3876

Molecular Weight*:
145661

pI*:
10.12

Net Charge*:
42.66

EC:
2.7.7.6  

Functional Class:
Transcription; DNA-dependent RNA polymerase  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribnucleoside triphosphates as substrates.

Activity: N nucleoside triphosphate = N pyrophosphate + RNA(N).

Bacterial RNA polymerase consists of a sigma factor and a core enzyme composed of two alpha, one beta and one beta' chains.

Reference: Eur J Biochem. 1981 Jun 1;116(3):621-9.

See MG022, a predicted rpoE sequence; MG054, a predicted nusG sequence; MG141, a predicted nusA sequence; MG177, a predicted rpoA sequence; MG249, a predicted rpoD sequence; and MG341, a predicted rpoB sequence.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to DNA-directed RNA polymerase beta chain
sequences, e.g. residues 13-1292 are 87% similar to RPOC_MYCPN.
MG340 is similar to T.pallidum TP0242, a predicted DNA-directed
RNA polymerase beta subunit. It is also similar to C.trachomatis
DNA-directed RNA polymerase beta subunit sequence CT314.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0086 is ehugpcmy.
COG name: DNA-dependent RNA polymerase beta' subunit (split gene in MJ, and probably erratically in Ssp).
Functional Class: K
BeTs to h,u,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 304-1285 represent 6 matches to blocks BL00115A,B,C,E,F,H,
concerned with Eukaryotic RNA polymerase II heptapeptide
repeat proteins, e.g. RPB0_ARATH, RPB1_SCHPO.
Residues 80-91 are matched to block PR00367A, concerned with
ethylene responsive element binding protein, e.g. ATU12546.
Residues 673-698 are matched to block BL00915A, concerned with
Phosphatidylinositol 3- and 4-kinases proteins, e.g. PI4K_HUMAN.

ProDom Summary:  Protein Domain Search
Residues 690-917, 494-585, 1131-1203, 167-233, 1044-1103, 294-376,
957-1007, 654-688, 918-956, 1229-1266, 1104-1130, 446-466, 623-639,
277-293 constitute defined domains of RPOC_MYCGE, domains from
RPOC_MYCPN support this assignment.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 14 to 405 (E-value = 3.2e-169) place MG340 in the RNA_pol_Rpb1_1 family which is described as RNA polymerase Rpb1, domain 1 (PF04997)
Residues 407 to 558 (E-value = 2e-79) place MG340 in the RNA_pol_Rpb1_2 family which is described as RNA polymerase Rpb1, domain 2 (PF00623)
Residues 561 to 741 (E-value = 1.5e-51) place MG340 in the RNA_pol_Rpb1_3 family which is described as RNA polymerase Rpb1, domain 3 (PF04983)
Residues 766 to 861 (E-value = 2.3e-26) place MG340 in the RNA_pol_Rpb1_4 family which is described as RNA polymerase Rpb1, domain 4 (PF05000)
Residues 863 to 1233 (E-value = 1.8e-26) place MG340 in the RNA_pol_Rpb1_5 family which is described as RNA polymerase Rpb1, domain 5 (PF04998)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
203  
284
coil-coil  
359  
393
non-globular  
1106  
1181

PDB Hit:


Gene Protein Sequence:
MTTTRRNKRNNKLYKNIKAIKLSIASNDTILNWSEGEVTKAETINYKSLK
PEPGGLFDEAIFGPVKDYECACGKFKKIKYRGVRCDRCGVWVTESIVRRE
RMGHIALVSPVAHIWMSKELPSPSKISLVLNISYKEVEQVLYFVNYIVLD
TGKIKDDKIMPFKFKEVLDLTGKGSLSTRQKMRRVIGYIFRNLIKSKSSE
DYRKGKIFYESLKNSSLPFSLNDAFNYIKKYTGFRVGIGAEAILELLNKI
DLNLEFSRLNDALRKAKKDSVEDAKVKKILRQLETISWFRNSKLHPKNMI
LHTVPVIPPDIRPIIQLDGAKFTTSDINNFYRRVIIRNDRLRRILEDGTV
PSIVVNNEKRLLQESVDALFDNSSRHKPSLSKDKRSLKSLTDRLKGKQGL
FRHNLLGKRVDYSGRSVIVVGPELKMYEVGIPALMILKLFKPFIIHGLIN
KFDENGNEIRPIAASIRQAEDMIKNQDDLIWGIVYDVIKDRPVLLNRAPT
LHRLGIQAFEPRIVDGKAIRLHPLVTTAFNADFDGDQMAVHVPLSENAVN
EARAVLLASKHILGLKDGRPIVTPTQDMVLGNYYLTTERKGQLGEGIIFS
TVYEARAAYESQKVHLHAIVGISTKAFPNKKFACQGTLITTVGKIIFNDV
LGNNVPYINDGEFDENACPEKFIVKQGEDVRQSILKHQIIPAFSKKVISK
LIDLLYLLLEFKDLPKTLDNIKALGFKYSTFSSTTVSVFDIPKYTNKQNY
FDSADQQVLKYKQFYNKGLLTDDERYKRVVKLWNNVKEKVSDEIQNLIKQ
EQYRDNSIVVMADSGARGNISNFTQLFGMRGLMSKSFNYERNNQSKIIKD
TIEVPIKHSFFEGLTINEYFNSSYGARKGMTDTAMKTAKSGYMTRKLVDA
THELIINHDDCGTRKGIVVEAIVETKTKSLIESLFDRIVNRYSITPIVDP
ETQKTIVEANSLITTQLAKQICATSIKEVLVRSVIYCERENGICQYCFGI
DLSTGKLVELGTAVGVIAAQSIGEPGTQLTMRTFHTGGVSTENNLAQGFE
RLKQIFEVVTPKDFEKAVISEVKGTVKSITTVQNAQEVVIKSNVDERIYT
IPFSAQIRVHVGDQVSPGSKITEGSVDIKQLLRIAGIQRVRQYMIVEIQK
VYRIQGIDIADKYVEIIIRQLTNLLQVTDAGNSNLFVGQLVHSHYLNELN
KSLLLAGKMPVIAINQVFGIDEAASKSNSFLSAASFQDTKKILTDAAVKN
QVDYLLGLKENVIIGGKIPAGTGFLTDEELTFLGSKTVAEEY

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACAACAAGACGTAATAAAAGAAATAACAAGCTTTATAAAAACAT
TAAAGCAATTAAACTTTCCATCGCTTCCAATGACACCATTTTGAACTGAT
CTGAAGGGGAAGTTACAAAAGCTGAAACCATTAACTATAAATCATTAAAA
CCAGAACCTGGAGGCTTGTTTGATGAAGCAATCTTTGGACCTGTTAAGGA
CTATGAATGTGCTTGTGGCAAGTTCAAAAAGATTAAATACCGTGGTGTGA
GGTGTGATCGCTGTGGGGTGTGAGTTACTGAATCTATTGTACGTAGAGAA
AGGATGGGACATATTGCACTTGTGAGTCCTGTAGCTCACATTTGGATGTC
AAAAGAATTACCATCTCCTTCCAAAATATCATTAGTTTTAAACATCTCTT
ACAAAGAGGTTGAACAGGTTTTGTACTTTGTTAACTACATAGTACTTGAT
ACAGGTAAGATCAAAGATGATAAAATCATGCCTTTTAAGTTCAAAGAAGT
TTTGGACTTAACTGGTAAGGGTTCACTTTCAACACGACAAAAAATGCGTC
GTGTGATAGGTTATATCTTCAGAAATCTCATTAAAAGTAAGAGTAGTGAA
GATTACCGTAAGGGAAAAATCTTTTATGAAAGTTTAAAAAACAGCTCTCT
CCCCTTTTCTCTAAATGATGCTTTTAATTACATTAAGAAGTACACTGGTT
TTAGGGTTGGAATAGGGGCTGAAGCAATTTTGGAATTGCTTAATAAAATC
GATCTTAACTTGGAATTTAGCAGGTTAAATGATGCTTTAAGAAAAGCCAA
GAAAGATAGTGTTGAAGATGCTAAAGTTAAGAAGATCTTAAGACAACTGG
AAACTATTAGTTGGTTTAGAAATTCTAAGCTTCATCCTAAAAACATGATC
TTACATACTGTTCCAGTTATCCCCCCTGATATCAGACCTATTATCCAACT
TGATGGTGCTAAGTTTACCACCAGTGACATCAACAATTTTTACCGCAGGG
TAATCATTAGAAATGACCGATTAAGAAGGATTTTGGAAGATGGTACTGTA
CCTTCTATTGTTGTTAACAATGAAAAAAGACTTTTACAAGAGTCTGTTGA
TGCTTTATTTGATAACTCTTCACGTCATAAACCATCACTTTCCAAAGACA
AACGGTCATTGAAATCTTTAACAGATCGTTTAAAAGGAAAACAAGGTTTA
TTTAGACACAACTTACTTGGTAAAAGAGTTGATTATTCAGGTAGAAGTGT
AATTGTGGTTGGCCCTGAATTGAAGATGTATGAAGTTGGGATCCCAGCAC
TAATGATCTTAAAGCTGTTTAAACCCTTTATTATCCATGGATTGATCAAT
AAGTTTGATGAAAATGGTAATGAGATTAGACCAATTGCCGCTTCCATCAG
ACAAGCTGAAGATATGATTAAAAACCAGGATGATCTTATCTGGGGAATAG
TTTATGATGTTATCAAAGATCGTCCCGTTTTACTAAATCGTGCTCCAACC
CTACATAGGTTAGGGATCCAAGCATTTGAACCAAGAATTGTTGATGGTAA
AGCAATTAGATTACACCCATTAGTAACTACTGCATTTAATGCTGATTTTG
ATGGTGATCAGATGGCAGTTCATGTTCCTTTAAGTGAGAATGCAGTTAAT
GAAGCAAGAGCTGTTCTGCTTGCATCAAAACATATCTTAGGTTTGAAAGA
TGGAAGACCTATTGTAACTCCTACTCAGGACATGGTTTTAGGTAACTATT
ATCTAACCACAGAGAGAAAAGGACAGTTGGGAGAGGGGATTATCTTCAGC
ACAGTTTATGAAGCACGTGCTGCTTATGAAAGTCAAAAGGTTCATTTACA
TGCTATTGTAGGGATAAGTACTAAAGCATTTCCCAACAAGAAGTTTGCAT
GCCAAGGAACTTTAATAACAACAGTTGGTAAGATTATCTTTAATGATGTT
TTAGGCAATAATGTTCCTTATATTAATGACGGGGAATTTGATGAAAATGC
ATGTCCCGAAAAGTTCATTGTGAAACAGGGAGAAGATGTAAGACAATCAA
TTTTAAAGCATCAAATTATCCCTGCATTTTCCAAAAAGGTTATTTCCAAG
TTAATCGATCTACTCTATCTTTTATTGGAATTTAAAGACCTTCCTAAAAC
ACTTGATAATATCAAAGCACTTGGCTTTAAGTACTCTACTTTTTCTTCAA
CTACTGTTTCAGTATTTGATATCCCTAAGTACACCAATAAACAAAATTAC
TTTGATAGTGCTGATCAACAGGTGCTGAAATACAAACAGTTTTATAACAA
GGGTTTGTTAACCGATGATGAACGTTATAAACGCGTTGTGAAGTTATGAA
ACAATGTGAAAGAAAAAGTATCTGATGAGATCCAAAACTTAATTAAACAA
GAACAGTACCGTGATAATTCCATTGTGGTAATGGCTGATTCAGGTGCTAG
AGGTAACATTTCTAACTTTACCCAGTTATTTGGGATGCGAGGCTTAATGT
CTAAAAGCTTTAACTATGAAAGAAATAACCAATCTAAGATCATTAAAGAT
ACGATAGAAGTTCCTATTAAACACTCCTTTTTTGAAGGTTTGACCATTAA
TGAATACTTCAACTCTTCTTATGGAGCGAGAAAAGGGATGACAGATACTG
CAATGAAAACAGCAAAGTCTGGTTATATGACAAGAAAGCTAGTAGATGCT
ACTCATGAATTAATTATTAACCATGATGATTGTGGAACAAGAAAAGGAAT
TGTTGTTGAAGCAATTGTTGAAACCAAAACCAAATCCTTGATTGAATCAT
TATTTGACAGGATTGTTAATCGCTACTCAATTACTCCTATAGTTGATCCT
GAAACACAAAAAACTATTGTAGAAGCTAACAGTCTTATTACAACGCAATT
AGCTAAACAGATTTGTGCAACATCTATTAAAGAAGTTTTAGTTAGATCTG
TTATCTATTGTGAAAGGGAAAATGGTATCTGTCAATACTGCTTTGGCATT
GACTTGTCAACTGGTAAGTTGGTGGAATTGGGAACTGCTGTTGGGGTGAT
TGCTGCTCAATCAATTGGTGAACCTGGGACCCAATTGACAATGCGTACTT
TCCATACTGGGGGAGTTTCAACTGAAAACAACTTAGCACAAGGCTTTGAA
CGTTTAAAACAGATCTTTGAAGTAGTTACTCCTAAAGATTTTGAAAAAGC
AGTTATCTCTGAAGTGAAAGGAACAGTTAAATCAATTACTACTGTTCAAA
ACGCTCAGGAAGTAGTGATTAAATCAAACGTTGATGAGAGGATTTATACT
ATCCCTTTCAGTGCTCAAATACGTGTTCATGTTGGTGATCAAGTTTCACC
AGGTTCTAAGATTACAGAAGGTTCTGTTGATATTAAACAACTTTTGCGAA
TTGCAGGTATCCAAAGGGTAAGACAATACATGATTGTAGAGATCCAAAAA
GTGTATAGGATTCAAGGGATAGATATTGCTGATAAGTATGTAGAAATTAT
TATCAGACAACTAACTAATTTGTTGCAAGTAACAGATGCAGGTAACAGCA
ATTTATTTGTTGGTCAGTTAGTGCATAGCCATTATCTCAATGAACTAAAT
AAGAGCTTACTTTTAGCTGGAAAGATGCCTGTTATTGCAATTAATCAGGT
GTTTGGAATTGATGAAGCGGCAAGTAAATCTAACTCCTTTTTAAGTGCTG
CATCCTTCCAAGATACCAAAAAAATCCTAACTGATGCTGCTGTTAAGAAC
CAAGTAGACTATCTTTTAGGTTTAAAAGAGAATGTTATTATTGGTGGAAA
AATTCCAGCAGGAACAGGATTTTTAACTGATGAAGAGTTAACTTTCTTAG
GTAGCAAAACAGTTGCTGAAGAGTAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy