Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR251 IGR246 IGR248 IGR247 IGR249 MG335.1 acpD, - MG333 cmk, - MG330 MG332 MG329 valS, - MG334 MG338 MG337 MG335.2 nifS, - MG336 MG335.1 acpD, - MG333 cmk, - MG330 MG332 MG329 valS, - MG334 MG338 MG337 MG335.2 nifS, - MG336 Type: inverted, Name:  - 63 acpD, - MG333 cmk, - MG330 MG332 MG329 valS, - MG334 MG338 MG335 MG331 MG331 MG335.1 MG335 MG337 MG335.2 nifS, - MG336
* Calculated from Protein Sequence

Gene ID: MG334

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
valS  

Definition:
valyl-tRNA synthetase

Gene Start:
419480

Gene Stop:
416970

Gene Length:
2511

Molecular Weight*:
97458

pI*:
10.03

Net Charge*:
29.52

EC:
6.1.1.9  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Valine, leucine and isoleucine biosynthesis
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
See Prosite PDOC00161.

From Prosite:

Aminoacyl-tRNA synthetases (EC 6.1.1.-) are a group of enzymes which activate amino acids and transfer them to specific tRNA molecules as the first step in protein biosynthesis. In prokaryotic organisms there are at least twenty different types of aminoacyl-tRNA synthetases, one for each different amino acid. In eukaryotes there are generally two aminoacyl-tRNA synthetases for each different amino acid: one cytosolic form and a mitochondrial form. While all these enzymes have a common function, they are widely diverse in terms of subunit size and of quaternary structure.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to valyl-tRNA synthetase sequences,
e.g. residues 1-836 are 65% similar to SYV_MYCPN.
MG334 is similar to T.pallidum TP1035, a predicted valyl-tRNA
synthetase, TP0452, a predicted isoleucyl-tRNA synthetase; it
shows weak similarity to TP0586, a predicted leucyl-tRNA
synthetase. It is also similar to C.trachomatis valyl, isoleucyl,
leucyl t-RNA synthetase sequences CT302, CT019, CT209.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0525 is ehugpcmy.
COG name: Valyl-tRNA synthetase.
Functional Class: J
BeTs to h,u,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 713-731 are matched to block PR00677D, concerned with
phosducin signature, e.g. PHOS_FELCA.
Residues 625-644 are matched to block PR00828I, concerned with
formin signature, e.g. FOR4_MOUSE.
Residues 46-56, 512-521 are matched to blocks BL00178A,B,
concerned with Aminoacyl-transfer RNA synthetases class-I
proteins, e.g. SYV_MYCPN.
Residues 200-218 are matched to blocks PR00337C, concerned with
LEU/ILE/VAL-BINDING protein family signature, e.g. LIVB_SALTY.

ProDom Summary:  Protein Domain Search
Residues 643-837, 53-179, 581-642, 248-289, 310-344, 529-553,
448-464, 481-497, 290-305 constitute defined domains of SYV_MYCGE.
Residues 245-285, 125-236, 303-413, 69-83 constitute a leucyl-tRNA
synthetase domain of SYL_METJA.

Paralogs:  Local Blast Search
MG334 is paralogously related to MG345(isoleucyl-tRNA synthetase)
and to MG266(leucyl-tRNA synthetase): residues 4-736 are 23%
similar to MG345 and residues 11-570 are 21% similar to MG266.
It is also weakly related to MG021(methionyl-tRNA synthetase):
residues 362-683 and 49-172 are 23% and 26% similar to MG021.

Pfam Summary:  Pfam Search
Residues 19 to 554 (E-value = 9.1e-162) place MG334 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
551  
649
coil-coil  
767  
794
coil-coil  
806  
837

PDB Hit:


Gene Protein Sequence:
MKDKFSFQKNYDFNLVSDGLYEIWNNAGFFKPKDKNNSFTAILPPPNLTG
TLHIGHAFEVSITDQIMRFKKMQGFSINWIPGFDHAGIATQTKYEKIALK
ENQKYFDADDDKKSEMIMNWALNQSEIIKNQLKSLGVCLNWSETKFTLSE
QANKIVNNCFKNLYENGFIYQAYTLVNWDTKLNTAISNIEVINKPVNQHL
HYVVYKLANDSKQELIVATTRPETIFADVCLLVNPKDKRYTNFWNKLVVN
PLTGKQIPVVTDSYVDIKFGTGILKCTPAHDFNDYEINTKYKFDFLSCID
SNGILNQNASKFQGLSVLQARNKIVKWLEKNKLLVKSIPLTSNVGFSERS
GTVVEPMLSKQWFVDLPKLKDHLYLKKYPDFIPKRFNKQVSNWLNKLKPW
CISRQLIWGHKIPVWFENNTGEIVVGEKPSKNLQNYTRSKDVLDTWFSSS
LWPLICLNWEQDDSFHETELLVTGYDILFFWVLRMLFNSFFETKKLPFKT
VLIHGLVRDEQNRKMSKSLNNGIDPVDLIRNYGADAVRLFLCSNHTPGDD
LIFSEQKIKSAWNFLNKLWNVTKFVIQLENDQEISYDLDKLSLSETWILA
KLDKVIQKITKLLDKFQLALANQILVKFVWDDFCNTFIEAIKKEPNQLKP
QLFYTAKSVLSNIAILLSITVPFLSERIYQQFNNKSVMQATWPLATKIKI
PKLFDLVLAAINDLRNYRKQYMLNSQQKLVVILSGKNAVDVKQYFNFSWI
ELKIETNKKVSFKYQIVDDTTQRLKSLQKQQAFFESEVKRSQAIVKNKSF
LEKAPKEKVKSEFLKLEEYQKKLTETNQLIAKLTKAH

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGATAAATTTAGTTTTCAAAAAAACTATGATTTCAACTTAGTTAG
TGATGGGCTTTATGAAATTTGAAATAATGCTGGTTTTTTTAAACCTAAAG
ATAAAAACAATTCTTTTACAGCAATTCTTCCCCCTCCAAATCTAACAGGT
ACTCTTCATATTGGTCATGCTTTTGAGGTTAGTATTACTGATCAAATCAT
GCGTTTTAAAAAGATGCAGGGATTTAGTATTAACTGAATTCCTGGCTTTG
ATCATGCTGGCATTGCTACTCAAACGAAATATGAAAAAATAGCATTAAAA
GAAAATCAAAAATATTTTGATGCAGATGATGATAAAAAATCTGAAATGAT
CATGAATTGGGCATTAAATCAAAGCGAAATAATTAAAAATCAACTAAAGA
GTTTAGGAGTTTGCTTAAATTGATCTGAAACTAAATTCACGCTTTCAGAA
CAAGCTAATAAAATTGTTAACAATTGTTTTAAAAACCTTTATGAAAACGG
TTTTATTTATCAAGCATACACGCTTGTTAATTGAGATACAAAATTGAATA
CTGCTATATCAAATATTGAAGTTATCAATAAACCTGTTAATCAACATCTT
CATTATGTTGTTTATAAACTAGCGAATGATAGTAAACAAGAACTAATAGT
TGCAACAACAAGACCAGAAACTATCTTTGCTGATGTTTGTCTATTGGTAA
ACCCAAAAGATAAGCGCTATACTAATTTCTGAAATAAATTAGTAGTTAAC
CCTTTAACAGGAAAACAAATTCCTGTTGTAACAGATAGCTATGTTGACAT
TAAATTTGGTACAGGAATATTGAAATGTACTCCTGCACACGACTTTAATG
ACTATGAAATCAACACTAAATATAAATTTGATTTTCTAAGCTGCATTGAC
AGTAACGGTATTCTCAATCAAAATGCAAGTAAATTTCAAGGCCTTAGTGT
TTTACAAGCAAGAAATAAAATTGTTAAATGATTAGAAAAAAATAAATTAC
TTGTTAAATCAATACCATTAACTAGTAATGTTGGTTTTTCTGAACGCAGT
GGCACTGTTGTAGAACCCATGCTTTCAAAACAGTGATTTGTTGATTTACC
AAAGTTAAAAGATCACTTATATTTAAAAAAATATCCTGATTTTATTCCCA
AACGCTTTAATAAGCAAGTGTCAAATTGGTTGAATAAACTCAAACCATGG
TGTATTTCAAGACAGTTAATTTGGGGTCATAAAATTCCTGTTTGATTTGA
AAACAATACAGGTGAAATAGTTGTTGGTGAAAAACCTTCAAAAAATTTAC
AAAACTACACTAGATCAAAAGATGTACTTGATACTTGATTTTCTTCTTCG
CTTTGACCTTTAATTTGTTTGAATTGAGAACAGGATGACTCTTTTCATGA
AACTGAGCTTTTAGTTACAGGTTATGATATTCTATTTTTCTGAGTTTTAA
GAATGTTATTTAACTCCTTTTTTGAAACTAAAAAACTGCCATTTAAAACT
GTTTTAATCCACGGTTTAGTACGCGATGAACAAAATCGTAAGATGTCAAA
ATCACTGAATAATGGCATTGATCCTGTTGATCTTATTAGAAATTATGGAG
CGGATGCAGTGCGCTTATTTTTGTGTTCAAATCACACTCCAGGAGATGAT
CTAATTTTCAGCGAACAAAAAATAAAAAGTGCATGAAATTTTTTAAATAA
ATTGTGGAATGTTACTAAGTTTGTTATCCAACTAGAAAATGATCAAGAAA
TTAGTTATGACTTGGACAAACTTTCATTAAGTGAAACTTGAATCTTAGCT
AAATTAGATAAAGTAATTCAAAAAATAACTAAGCTACTAGATAAATTCCA
GTTAGCATTAGCAAACCAAATTCTTGTTAAATTTGTTTGGGATGATTTTT
GCAATACTTTCATTGAAGCAATTAAAAAAGAACCAAATCAACTAAAACCA
CAGCTTTTTTATACTGCTAAATCAGTTTTATCTAATATTGCTATTTTGCT
TAGTATCACTGTTCCTTTTTTATCTGAGCGTATTTATCAGCAATTTAACA
ATAAAAGTGTTATGCAAGCAACATGACCTCTTGCAACTAAAATTAAAATT
CCCAAACTTTTTGATCTTGTTTTAGCTGCTATTAATGACTTACGCAATTA
CAGAAAACAGTACATGCTTAATTCACAACAAAAACTAGTTGTTATCTTAT
CTGGTAAAAATGCTGTTGATGTTAAACAATACTTTAACTTTAGTTGAATT
GAACTGAAAATTGAAACTAATAAAAAAGTTAGTTTTAAATACCAAATTGT
TGATGATACAACCCAAAGACTTAAATCTCTACAGAAGCAACAAGCTTTTT
TTGAAAGTGAAGTAAAACGTAGCCAAGCTATTGTTAAAAATAAAAGCTTT
CTAGAAAAAGCACCCAAAGAAAAGGTAAAAAGTGAATTTTTAAAATTGGA
AGAATATCAAAAAAAACTTACTGAAACCAACCAATTAATTGCTAAATTAA
CTAAAGCTCAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy