Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR246 IGR248 IGR247 IGR245 IGR249 MG335.1 acpD, - MG333 cmk, - MG330 MG332 MG329 fcrV, - MG328 valS, - MG334 MG335.2 nifS, - MG336 MG335.1 acpD, - MG333 cmk, - MG330 MG332 MG329 fcrV, - MG328 valS, - MG334 MG335.2 nifS, - MG336 Type: inverted, Name:  - 63 acpD, - MG333 cmk, - MG330 MG332 MG329 fcrV, - MG328 valS, - MG334 MG335 MG331 MG331 MG335.1 MG335 nifS, - MG336 MG335.2
* Calculated from Protein Sequence

Gene ID: MG333

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
acpD  

Definition:
acyl carrier protein phosphodiesterase, putative, authentic frameshift

Gene Start:
416716

Gene Stop:
416339

Gene Length:
378

Molecular Weight*:
14018

pI*:
9.94

Net Charge*:
3.94

EC:
3.1.4.14  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pantothenate and CoA biosynthesis  

Pathway: pathway table
Pantothenate and CoA biosynthesis

Primary Evidence:
C.A. Hutchinson, S.N. Peterson, S.R. Gill, R.T. Cline, O. White, C.M. Fraser, H.O. Smith, and J.C. Venter:
"Global transposon mutagenesis and a minimal mycoplasma genome"
Science, MS# 1042937, in press, 1999.

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to Acyl carrier protein phosphodiesterase
and its related sequences, e.g. residues 3-126 are 77% similar to
ACPD_MYCPN.
MG333 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0431 is eh-gpc-y.
COG name: Acyl carrier protein phosphodiesterase.
Functional Class: I
BeTs to h,g,y.

Blocks Summary:  Blocks Search
NONE.

ProDom Summary:  Protein Domain Search
Residues 1-126 constitute defined domain of Y333_MYCGE.
Residues 3-94 support this assignment.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MLLKTAYGIVILAPMTNFNYPASLKNFIDHVFVANKTFQDKYVTKGASKG
LLTNLKVVVLASQGAPLGWYPWADHVSNLKGLFGFAGVTHFESVLIDDTK
ILYKDKNKQEVVDLFAHKVDQVANNF

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCCTAAAAACAGCTTATGGAATTGTTATCCTTGCACCAATGACCAA
CTTTAATTATCCTGCTAGTTTAAAAAACTTTATTGATCATGTCTTTGTAG
CTAATAAAACCTTTCAAGACAAATATGTTACTAAAGGTGCTTCTAAGGGA
TTACTTACTAATCTTAAGGTAGTTGTTTTAGCGTCACAAGGTGCACCATT
AGGATGATACCCTTGAGCTGATCATGTTAGTAATTTAAAGGGCTTGTTTG
GTTTTGCAGGTGTTACACATTTTGAGAGTGTTTTAATTGATGACACTAAA
ATTCTTTACAAAGATAAAAACAAGCAAGAGGTAGTTGATCTGTTTGCACA
CAAAGTTGACCAAGTTGCTAATAATTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy