Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR246 IGR248 IGR247 IGR244 IGR245 IGR249 acpD, - MG333 cmk, - MG330 MG332 MG326 MG329 fcrV, - MG328 valS, - MG334 acpD, - MG333 cmk, - MG330 MG332 MG326 MG329 fcrV, - MG328 valS, - MG334 Type: inverted, Name:  - 63 acpD, - MG333 cmk, - MG330 MG332 MG329 fcrV, - MG328 valS, - MG334 MG335 MG331 MG327 MG335 MG331 MG326 MG327
* Calculated from Protein Sequence

Gene ID: MG330

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
cmk  

Definition:
cytidylate kinase

Gene Start:
414975

Gene Stop:
414325

Gene Length:
651

Molecular Weight*:
24729

pI*:
10.36

Net Charge*:
9.00

EC:
2.7.4.14  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to Cytidylate kinase sequences,
e.g. residues 1-217 are 63% similar to KCY_MYCPN.
MG330 is similar to T.pallidum TP0279, a predicted
ribosomal protein S1 sequence. It is also similar to
C.trachomatis Cytidylate kinase sequence CT452.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0283 is eh-gpc--.
COG name: Cytidylate kinase.
Functional Class: F
BeTs to h,g,c.

Blocks Summary:  Blocks Search
NONE.

ProDom Summary:  Protein Domain Search
Residues 5-190, 191-213 constitute defined domains of KCY_MYCGE.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 54 to 209 (E-value = 2.8e-89) place MG330 in the Cytidylate_kin family which is described as Cytidylate kinase (PF02224)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
55  
149

PDB Hit:


Gene Protein Sequence:
MNWQIAIDGPSSSGKSSVAKKIAEELDFFYFSSGKMYRAFAYVMQVNRLN
IDLFLKIINQINWRFEKDAVYYNNADITTVITTQSVANIASKIAVDPNIR
KIAVIKQQKLAENKNIVMDGRDIGTVVLKNAQLKFFLDAKVEIRAQRRLQ
DMGISLSNEKKLKELIQELKQRDQIDSSRTADPLKKAQDAIYLDTSELSF
DAVVKQTLKEAKKVFKL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTGACAAATAGCAATTGATGGTCCAAGTAGTTCTGGAAAGTCCAG
TGTTGCTAAAAAAATAGCTGAAGAACTTGATTTTTTTTATTTTTCTAGTG
GAAAAATGTATCGTGCCTTTGCCTATGTAATGCAAGTGAATAGATTAAAT
ATTGATCTTTTTTTAAAAATCATTAATCAAATTAACTGACGCTTTGAGAA
AGATGCTGTGTATTATAACAATGCTGATATTACAACAGTTATTACAACCC
AATCAGTTGCTAACATTGCTAGTAAAATAGCTGTTGATCCTAACATTAGA
AAAATTGCAGTTATTAAACAACAGAAACTAGCAGAAAATAAAAACATAGT
GATGGATGGTAGAGACATAGGAACAGTAGTTTTAAAAAATGCTCAATTGA
AGTTTTTTTTAGATGCTAAAGTTGAAATTAGAGCGCAGCGAAGATTACAA
GATATGGGAATTTCTCTATCAAATGAAAAAAAACTAAAGGAACTAATTCA
AGAATTAAAGCAACGTGATCAAATTGATAGTTCTAGAACTGCAGACCCAT
TAAAAAAAGCCCAGGACGCTATTTATCTTGACACTTCTGAACTAAGTTTT
GATGCAGTAGTAAAACAAACCCTCAAAGAAGCAAAGAAGGTTTTTAAACT
T


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy