Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR242 IGR246 IGR247 IGR244 IGR243 IGR245 IGR240 rpL33, - MG325 MG331 cmk, - MG330 MG326 pepP, - MG324 MG329 KtrB, - MG322 fcrV, - MG328 KtrA, - MG323 rpL33, - MG325 MG331 cmk, - MG330 MG326 pepP, - MG324 MG329 KtrB, - MG322 fcrV, - MG328 KtrA, - MG323 rpL33, - MG325 cmk, - MG330 MG326 pepP, - MG324 MG329 KtrB, - MG322 fcrV, - MG328 MG327 MG323.1 MG327 MG323.1 MG331 KtrA, - MG323
* Calculated from Protein Sequence

Gene ID: MG327

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
putative esterase/lipase 2

Gene Start:
410676

Gene Stop:
409873

Gene Length:
804

Molecular Weight*:
30686

pI*:
10.62

Net Charge*:
19.87

EC:
3.1.-.-  

Functional Class:
Fatty acid and phospholipid metabolism; Degradation  

Pathway: pathway table
Miscellaneous enzymes

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to putative esterase/lipase sequences
and to triacylglycerol lipase sequences, e.g. residues 2-267
are 66% similar to ESL2_MYCPN.
MG327 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0570 is ehugpc-y.
COG name: Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold.
Functional Class: R
BeTs to h,u,g,c,y.

Blocks Summary:  Blocks Search
Residues 94-107, 205-219 are matched to blocks PR00111B,D,
concerned with Alpha/Beta hydrolase fold signature, e.g. PSEACOX3.

ProDom Summary:  Protein Domain Search
Residues 25-120 are 67% similar to a PUTATIVE ESTERASE/LIPASE 2
domain, e.g. ESL2_MYCPN.
residues 27-125 are 36% similar to a putative esterase/lipase 1
domain represented by ESL1_MYCPN.
Residues 19-104 are 37% similar to a putative esterase/lipase 3
domain represented by ESL3_MYCPN.
Residues 112-259 are 29% similar to a putative esterase/lipase 1
domain represented by ESL1_MYCGE.
Residues 26-104 are 31% similar to a tropinesterase domain
represented by TPES_PSEPU.

Paralogs:  Local Blast Search
MG327 is paralogously related to MG310 (proline iminopeptidase )
and MG344 (lipase-esterase): residues 27-259 are 26% similar to
MG310, residues 16-264 are 24% similar to MG344.

Pfam Summary:  Pfam Search
Residues 50 to 258 (E-value = 4e-08) place MG327 in the Abhydrolase_1 family which is described as alpha/beta hydrolase fold (PF00561)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
93  
127

PDB Hit:


Gene Protein Sequence:
MLTSNKNTLFNSIFAFKPKKRKNVFIFLHGFGSEYASFSRIFSLFKKKKW
PFFTFNFPGHGDNESTDTDQLKLNHFVDLVCDFIVQKKLNNVILIGHSMG
GAVAVLVNKVIPLKIKALILVAPMNQTSFSVNKKRILDTFFKRNNSNHKD
FVEHEEKRKSLLKIAINAFKKRTTFKTLYSDMVQNAKYGNDSLERAYEMI
GNKPTLVILGANDIVTPTKASVDYLANKSDKIIFKVIDGVGHSPHDSAPK
LFFDYVLEFLDNLKKQRY

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAACGAGTAATAAAAATACTCTTTTTAACTCAATATTTGCCTTTAA
ACCTAAAAAAAGAAAAAACGTTTTTATTTTTTTACATGGATTTGGAAGCG
AATATGCCAGTTTTAGTCGTATTTTTAGCTTGTTTAAAAAGAAAAAGTGG
CCTTTCTTTACTTTTAATTTTCCCGGTCATGGAGACAATGAATCAACAGA
TACAGATCAATTAAAACTAAACCACTTTGTTGATTTGGTTTGTGATTTTA
TTGTTCAAAAAAAACTAAATAACGTCATTTTAATAGGTCATAGTATGGGA
GGTGCTGTGGCTGTTTTAGTTAACAAAGTTATACCACTAAAAATTAAGGC
TTTAATATTAGTAGCTCCTATGAATCAAACTTCTTTCTCAGTTAATAAAA
AGCGGATTTTAGATACTTTTTTTAAGCGTAATAACAGCAACCATAAGGAT
TTTGTTGAACATGAAGAAAAACGTAAATCACTTTTGAAAATAGCTATCAA
TGCATTTAAAAAAAGAACTACCTTTAAAACACTTTACAGTGATATGGTTC
AAAACGCTAAATATGGTAATGACTCACTTGAAAGGGCTTATGAAATGATT
GGTAATAAACCTACCTTAGTTATTTTAGGAGCTAATGATATTGTCACGCC
AACCAAAGCTTCTGTAGACTATCTAGCTAATAAAAGTGACAAGATTATTT
TTAAGGTTATTGATGGTGTTGGTCATTCACCACACGACTCAGCGCCTAAA
CTTTTTTTTGATTATGTGCTAGAGTTTCTAGATAATTTAAAGAAACAAAG
GTAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy