Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-3 tRNA-Asn-1 tRNA-Val-1 tRNA-Thr-2 tRNA-Lys-2 tRNA-Glu-1 IGR242 IGR244 IGR243 IGR245 IGR240 IGR239 rpL33, - MG325 MG326 pepP, - MG324 MG329 KtrB, - MG322 fcrV, - MG328 KtrA, - MG323 rpL33, - MG325 MG326 pepP, - MG324 MG329 KtrB, - MG322 fcrV, - MG328 KtrA, - MG323 rpL33, - MG325 MG326 pepP, - MG324 MG329 KtrB, - MG322 fcrV, - MG328 MG327 MG323.1 MG327 MG323.1 KtrA, - MG323
* Calculated from Protein Sequence

Gene ID: MG324

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pepP  

Definition:
XAA-pro aminopeptidase

Gene Start:
408792

Gene Stop:
407731

Gene Length:
1062

Molecular Weight*:
39802

pI*:
9.57

Net Charge*:
10.17

EC:
3.4.11.9  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous enzymes

Comment:
Enzyme that releases amino acids N-terminal to proline.

See Prosite PDOC00417 and PDOC00575.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to XAA-pro aminopeptidase sequences,
e.g. residues 1-354 are 78% similar to AMPP_MYCPN.
MG324 is similar to T.pallidum TP0842, a predicted methionine
aminopeptidase sequence; it shows weak similarity to TP0569
aminopeptidase P sequence. It is also similar to C.trachomatis
XAA-PRO aminopeptidase and methionine aminopeptidase sequences
CT574 and CT851.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0006 is ehugpcmy.
COG name: Xaa-Pro aminopeptidase.
Functional Class: E
BeTs to e,u,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 185-196, 286-298, 310-324, 329-342 are members of blocks
BL00491A,B,C,D(Aminopeptidase P and proline dipeptidase proteins).
Residues 126-165, 204-232, 260-305 are matched to blocks BL00680A,C,D,
concerned with Methionine aminopeptidase subfamily 1 proteins,
e.g. AMP2_SYNY3.

ProDom Summary:  Protein Domain Search
Residues 1-131, 132-314, 315-338 constitute PUTATIVE XAA-PRO
aminopeptidase[(X-PRO aminopeptidase) (aminopeptidase P)
(aminoacylproline aminopeptidase)] domains of AMPP_MYCGE.
Residues 8-65 are 36% similar to a putative peptidase in
GCVT-SPOIIIAA intergenic region domain represented by YQHT_BACSU.

Paralogs:  Local Blast Search
MG324 is weakly related to MG172(methionine amino peptidase),
residues 128-320 are 26% similar to MG172.

Pfam Summary:  Pfam Search
Residues 285 to 345 (E-value = 8.9e-23) place MG324 in the Peptidase_M24 family which is described as metallopeptidase family M24 (PF00557)

PDB Hit:
gi|2392623|pdb|1XGS|A Chain A, Methionine Aminopeptidase From Hyperthermophile Pyrococcus Furiosus Aminopeptidase, Hyperthermophile Mol_id: 1; Molecule: Methionine Aminopeptidase; Chain: A, B; Biological_unit: Active As A Monomer; Other_details: Contain T

Gene Protein Sequence:
MISELQQKITVLKDLLKTNKADAILIGSDQNRFWLTNFPSSAGWLIITSN
KAKLFIDGRYYEAARNFINPIVEVELFVSFKQVKAFCESNGINHLLIEGD
YLTFNYQDWIQAICKQYTVINAQEIRRVKLPSEIQAIEKAVDITRKVAVK
LKRFIKPKMTELFISQWITNELVKQGGAKNSFDPIVATGKNGANPHHKPT
KTIVKEGDFITCDFGTIYNGYCSDITRTFLVGKKPKSAKLLSAYKKVEEA
NLAGINAVNTTLTGSQVDKVCRDIIENSEFKDFFVHSTGHGVGIDIHEMP
NVSQSYNKLLCENGVVTIEPGIYIPNLGGIRIEDMVLVKKEKSVWLSKSI
PRAF

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTAGTGAATTACAACAAAAAATTACAGTTCTTAAAGATCTTTTAAA
AACCAATAAAGCTGATGCTATCCTAATTGGTTCTGATCAAAACCGCTTTT
GATTAACTAATTTTCCAAGTAGTGCAGGGTGGTTAATCATCACCAGCAAT
AAAGCAAAATTGTTTATTGATGGTAGGTATTATGAAGCAGCAAGGAACTT
TATTAATCCTATTGTTGAAGTTGAATTATTTGTTAGTTTTAAACAAGTTA
AAGCTTTTTGTGAATCTAATGGTATCAATCACCTTTTAATTGAGGGTGAC
TATCTTACCTTTAACTATCAGGATTGAATTCAAGCTATTTGTAAACAATA
CACAGTAATTAATGCCCAAGAGATTAGAAGAGTAAAGTTGCCTAGTGAGA
TTCAAGCCATTGAAAAAGCAGTTGATATTACAAGAAAAGTAGCAGTTAAG
TTAAAGCGTTTTATTAAACCAAAAATGACTGAGCTTTTCATTTCACAATG
GATTACTAATGAGCTTGTGAAGCAGGGTGGGGCTAAAAACTCATTTGATC
CTATAGTAGCTACTGGTAAAAACGGTGCTAACCCACATCACAAACCAACC
AAAACAATAGTTAAGGAAGGTGATTTTATCACTTGTGATTTTGGCACCAT
TTACAACGGTTATTGCTCTGATATTACAAGAACCTTTTTAGTTGGTAAAA
AACCTAAAAGTGCAAAGTTATTATCTGCATACAAAAAAGTTGAAGAGGCT
AATTTGGCTGGTATAAATGCAGTAAACACTACTTTAACAGGTTCACAAGT
TGATAAGGTGTGCCGCGATATTATTGAAAACTCTGAGTTTAAAGACTTTT
TTGTGCATAGTACTGGTCATGGCGTTGGTATTGATATCCATGAAATGCCA
AATGTTTCCCAATCTTACAACAAGTTATTGTGTGAAAATGGGGTTGTAAC
CATTGAACCTGGGATCTATATTCCTAACCTTGGTGGAATTAGGATAGAAG
ATATGGTACTTGTTAAAAAAGAAAAATCAGTTTGATTATCTAAATCTATC
CCACGTGCTTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy