Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-3 tRNA-Asn-1 tRNA-Val-1 tRNA-Thr-2 tRNA-Lys-2 tRNA-Glu-1 tRNA-Leu-2 IGR242 IGR244 IGR243 IGR240 IGR239 rpL33, - MG325 MG326 pepP, - MG324 KtrB, - MG322 fcrV, - MG328 MG321 KtrA, - MG323 rpL33, - MG325 MG326 pepP, - MG324 KtrB, - MG322 fcrV, - MG328 MG321 KtrA, - MG323 Type: inverted, Name:  - 56 rpL33, - MG325 MG326 pepP, - MG324 KtrB, - MG322 fcrV, - MG328 MG321 MG327 MG323.1 MG327 MG323.1 KtrA, - MG323
* Calculated from Protein Sequence

Gene ID: MG323.1

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Mycoplasma-specific hypothetical protein

Gene Start:
407783

Gene Stop:
406977

Gene Length:
807

Molecular Weight*:
31556

pI*:
0.00

Net Charge*:
0.00

EC:
 

Functional Class:
Unknown; Mycoplasma-specific protein  

Pathway: pathway table

Comment:
This protein is not in the original genbank record.
But it is in http://www.tigr.org/~clyde/Mgengenes99.html

Blast Summary:  PSI-Blast Search
Residues 28-240 are 47% similar to hypothetical protein P01_orf243 - Mycoplasma pneumoniae.
No significant similarity to C.trachomatis, C.pneumoniae, T.pallidum, or U.urealyticum.

COGS Summary:  COGS Search
None.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 28-267 are 55% similar to a defined domain of P75314_MYCPN, defined as P01_ORF243 PROTEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LLKKKNQFDYLNLSHVLSKKKNSGGGWINKISDKLSEINVAEYQVVSKHS
NYLFYSRFGLLDTFVYFLFFLCFFLNNVLFLAGVFHTKQFTFNEVNGFNQ
FYLFWTVEKPTDIIQASITYQISQYGIANLVFGLISLALLVFLSFRWTVS
LFFKSQTTKWERIGYTTGFFISIVVYLLWILLMVLFLVLLDQQFFERDTQ
KIQSATRFSLFFNVENNNGVYLSKLNSFGVFATAWAISLVFYSFFFIAIF
AFNYNKTKLKQLFKKSKAK

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTAAAAAAGAAAAATCAGTTTGATTATCTAAATCTATCCCACGTGCT
TTCTAAAAAGAAAAATAGTGGTGGTGGTTGGATTAATAAGATATCTGATA
AACTCAGTGAAATAAATGTCGCTGAGTATCAAGTTGTTTCCAAACACAGT
AACTATCTGTTTTACAGCAGGTTTGGCTTACTTGATACTTTTGTTTACTT
TTTATTTTTTCTCTGCTTTTTTCTAAACAACGTTTTGTTTTTAGCTGGCG
TTTTTCACACTAAACAATTCACTTTTAACGAAGTTAACGGCTTTAATCAG
TTTTACCTTTTTTGAACTGTTGAAAAACCAACTGATATTATTCAAGCTAG
TATTACTTATCAGATTAGTCAATATGGAATTGCTAACTTAGTTTTTGGGT
TAATTAGTTTAGCATTATTAGTTTTTCTAAGTTTTAGATGAACTGTTTCA
TTATTTTTTAAAAGTCAGACTACTAAGTGAGAGCGCATTGGCTATACTAC
TGGATTTTTTATCAGTATTGTTGTTTATCTCTTATGGATCTTGCTAATGG
TTTTATTTTTGGTGTTATTAGACCAACAGTTTTTTGAAAGAGATACACAA
AAAATTCAATCAGCAACGCGGTTTAGCTTGTTTTTTAATGTTGAAAATAA
CAATGGTGTTTATCTCTCTAAATTAAATAGTTTTGGTGTATTTGCTACCG
CTTGAGCGATTAGCTTAGTTTTTTATTCTTTCTTTTTTATAGCTATCTTT
GCTTTTAATTACAACAAAACCAAATTAAAACAACTCTTTAAAAAGAGTAA
GGCAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy