Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR227 IGR229 IGR230 IGR228 IGR231 rpS4, - MG311 MG313 deaD_1, - MG308 hmw1_1, - MG312 MG309 MG310 rpS4, - MG311 MG313 deaD_1, - MG308 hmw1_1, - MG312 MG309 MG310 Type: direct, Name:  - 27 Type: direct, Name:  - 48 Type: tandem, Name:  - 12 Type: tandem, Name:  - 10 Type: direct, Name:  - 48 Type: direct, Name:  - 45 Type: tandem, Name:  - 11 Type: inverted, Name:  - 63 Type: direct, Name:  - 27 Type: direct, Name:  - 45 rpS4, - MG311 MG313 deaD_1, - MG308 hmw1_1, - MG312 MG309 MG310
* Calculated from Protein Sequence

Gene ID: MG310

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
predicted acyltransferase/hydrolase with the alpha/beta hydrolase fold (putative esterase/lipase 1)

Gene Start:
386462

Gene Stop:
387265

Gene Length:
804

Molecular Weight*:
30733

pI*:
8.20

Net Charge*:
3.74

EC:
3.1.-.-  

Functional Class:
Fatty acid and phospholipid metabolism; Degradation  

Pathway: pathway table

Comment:
It is possible that MG310 should be defined as a putative triacylglycerol lipase (EC 3.1.1.3). Gapped BLAST show residues 18-263 have 21% identity to g1086273 which is annotated as triacylglycerol lipase from Mycoplasma mycoides subsp.

In Mycoplasma mycoides subsp., experimental evidence reveals that this enzyme plays an essential role in the mycoplasmal nutritional requirement for long-chain fatty acids by hydrolysis of triacylglycerols ester bonds to yield free fatty acids, diacylglycerol and monoacylglycerol.

COG and Pfam analysis of the Mycoplasma mycoides triacylglycerol lipase reveal it also belongs to the alpha/beta hydrolase fold family.

See: Rawadi G et al. (1995) Cloning and characterization of the lipase operon from Mycoplasma mycoides subspecies mycoides LC. Gene 158:107-11.


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to putative esterase/lipase sequences
and to triacylglycerol lipase sequences, e.g. residues 1-268
are 57% similar to ESL1_MYCPN.
MG310 shows no significant similarities to T.pallidum and
C.trachomatis sequences.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0570 is ehgpc-y.
COG name: Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold.
Functional Class: R
BeTs to h,g,y.

Blocks Summary:  Blocks Search
Residues 45-60, 90-103, 50-63, 208-222 are matched to blocks
PR00111A-D, concerned with Alpha/Beta hydrolase fold signature,
e.g. DMPD_PSEPU.
Residues 87-100 are matched to blocks BL01173C, concerned with
Lipolytic enzymes "G-D-X-G" family, histidine, e.g. BAH_STRHY.

ProDom Summary:  Protein Domain Search
Residues 113-263 constitute defined domain of ESL1_MYCGE.
Residues 23-125 are 64% similar to a putative esterase/lipase 1
domain represented by ELS1_MYCPN.
Residues 25-117 are 37% similar to a putative esterase/lipase 2
domain represented by ESL2_MYCPN.
Residues 23-100 are 29% similar to a putative esterase/lipase 3
domain represented by ESL3_MYCPN.
Residues 23-118 are 28% similar to a BEM46 protein (fragment)
domain represented by BE46_SCHPO.
Residues 23-100 are 30% similar to a probable dihydrolipoamide
acetyltransferase domain represented by ACOC_ALCEU.

Paralogs:  Local Blast Search
MG310 is paralogously related to MG327(magnesium-chelatase
30 kDa subunit), residues 25-263 are 26% similar to MG327.
It is also weakly related to MG344(lipase-esterase), residues
23-262 are 19% similar to MG344.

Pfam Summary:  Pfam Search
Residues 46 to 262 (E-value = 3.1e-05) place MG310 in the Abhydrolase_1 family which is described as alpha/beta hydrolase fold (PF00561)

PDB Hit:


Gene Protein Sequence:
MRLEIENGLEFVNDPVVNELGKICFFHPFTGNLTNKLSFRSHFNRYSFYA
INYPGHGNSVINNPKQLEFSYWLEITKQFFDKHNLKDVILFGHSIGGGLA
VALTNYLSSDQYKAVLLEAPLNPAIVETPLNIVQNLIPDPDSDFAVIQKC
LVYNIEKKLGANFKEYCEREKQKSIHQNQRLKVMLEPSTLKQNIVLINAA
FLKLNCPALWIHGKQDGIIKYLPSKAYYESLNNKQIQFKAIEAAAHTPYF
EQPQKFLSLVNDFFQLIS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGACTTGAAATAGAAAACGGGCTTGAATTTGTCAATGATCCTGTGGT
AAATGAACTTGGCAAGATCTGTTTTTTTCATCCTTTTACAGGTAATTTAA
CAAACAAACTTAGTTTCAGAAGTCATTTCAATAGATACAGTTTTTATGCC
ATTAACTACCCAGGGCATGGTAATAGTGTTATTAACAATCCAAAGCAACT
TGAATTTAGTTACTGATTGGAAATTACAAAACAGTTTTTTGATAAACATA
ACTTAAAGGATGTAATCTTATTTGGTCATTCTATTGGCGGTGGTTTAGCA
GTTGCTTTAACTAACTATTTAAGCAGTGATCAATATAAAGCAGTCTTGTT
AGAAGCACCATTAAATCCTGCTATTGTTGAAACTCCTTTAAATATTGTTC
AAAATCTCATTCCTGATCCTGATAGTGATTTTGCTGTTATTCAAAAGTGT
CTTGTTTACAATATTGAGAAAAAACTTGGGGCAAACTTTAAAGAATATTG
TGAAAGAGAAAAGCAAAAATCAATTCACCAAAACCAACGCCTTAAAGTGA
TGTTAGAACCTTCTACACTCAAACAAAACATAGTTTTAATCAATGCAGCT
TTTTTAAAGTTAAATTGTCCTGCTTTGTGAATCCATGGTAAGCAGGATGG
AATTATTAAGTACCTTCCATCCAAGGCTTATTATGAATCATTAAACAATA
AGCAAATTCAATTTAAAGCCATAGAAGCAGCGGCTCATACCCCTTACTTT
GAACAACCACAAAAGTTTTTAAGTTTAGTTAATGATTTCTTTCAATTAAT
AAGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy