Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR222 IGR223 IGR224 IGR221 pta, - MG299 glnQ_2, - MG303 pgk, - MG300 hsp70,dnaK, - MG305 p115, - MG298 pta, - MG299 glnQ_2, - MG303 pgk, - MG300 hsp70,dnaK, - MG305 p115, - MG298 Type: inverted, Name:  - 63 pta, - MG299 glnQ_2, - MG303 pgk, - MG300 hsp70,dnaK, - MG305 p115, - MG298 cbiO, - MG304 MG302 gap, - MG301 cbiO, - MG304 MG302 gap, - MG301
* Calculated from Protein Sequence

Gene ID: MG301

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gap  

Definition:
glyceraldehyde-3-phosphate dehydrogenase

Gene Start:
371962

Gene Stop:
370952

Gene Length:
1011

Molecular Weight*:
37085

pI*:
9.63

Net Charge*:
8.99

EC:
1.2.1.12  

Functional Class:
Energy metabolism; Glycolysis and Gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Metabolism of Other Amino Acids; D-Arginine and D-ornithine metabolism

Comment:
See Gu et al. J.Bact.177:2594 (1995).

See Prosite PDOC00069.

From Prosite:

Glyceraldehyde 3-phosphate dehydrogenase (EC 1.2.1.12) (GAPDH) is a tetrameric NAD-binding enzyme common to both the glycolytic and gluconeogenic pathways. A cysteine in the middle of the molecule is involved in forming a covalent phosphoglycerol thioester intermediate.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to glyceraldehyde-3-phosphate
dehydrogenase sequences, e.g. residues 1-337 are 79%
similar to G3P_MYCPN.
MG301 is similar to T.pallidum TP0844, a glyceraldehyde
3-phosphate dehydrogenase sequence. It is also similar to
C.trachomatis glyceraldehyde 3-phosphate dehydrogenase
sequence CT505.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0057 is ehgpcmy.
COG name: Glyceraldehyde-3-phosphate dehydrogenase.
Functional Class: C
BeTs to e,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 9-330 represent 7 matches to blocks BL00071A-E,
(Glyceraldehyde 3-phosphate dehydrogenase proteins).
Residues 171-178 are matched to block PR00055B, concerned with
HIV TAT domain signature, e.g. HIV1U01465.
Residues 9-23 are matched to block PR00335A, concerned with
TRKA potassium uptake protein signature, e.g. KEFC_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 10-37, 43-331 constitute defined domains of
G3P_MYCGE, residues 9-41 of G3P_CLOPA support this
assignment.

Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 8 to 157 (E-value = 2.3e-88) place MG301 in the Gp_dh_N family which is described as Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain (PF00044)
Residues 158 to 317 (E-value = 2.9e-96) place MG301 in the Gp_dh_C family which is described as Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain (PF02800)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
32

PDB Hit:
gi|999601|pdb|1HDG|O Chain O, Holo-D-Glyceraldehyde-3-Phosphate Dehydrogenase (E.C.1.2.1.12) (Synchrotron X-Ray Diffraction)

Gene Protein Sequence:
MAAKNRTIKVAINGFGRIGRLVFRSLLSKANVEVVAINDLTQPEVLAHLL
KYDSAHGELKRKITVKQNILQIDRKKVYVFSEKDPQNLPWDEHDIDVVIE
STGRFVSEEGASLHLKAGAKRVIISAPAKEKTIRTVVYNVNHKTISSDDK
IISAASCTTNCLAPLVHVLEKNFGIVYGTMLTVHAYTADQRLQDAPHNDL
RRARAAAVNIVPTTTGAAKAIGLVVPEANGKLNGMSLRVPVLTGSIVELS
VVLEKSPSVEQVNQAMKRFASASFKYCEDPIVSSDVVSSEYGSIFDSKLT
NIVEVDGMKLYKVYAWYDNESSYVHQLVRVVSYCAKL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGCAAAGAATAGAACCATTAAGGTTGCAATCAATGGTTTTGGAAG
AATTGGAAGACTTGTTTTTCGTTCTCTTCTCAGTAAGGCAAATGTTGAAG
TTGTAGCAATTAATGATTTGACCCAACCTGAAGTTTTAGCGCACCTGTTG
AAATATGATTCAGCTCATGGTGAATTGAAAAGAAAGATTACTGTTAAACA
AAACATCTTGCAAATTGATAGAAAAAAGGTTTATGTTTTTAGTGAAAAAG
ATCCCCAAAATTTACCTTGGGATGAACATGATATTGATGTAGTAATTGAA
TCAACTGGTAGGTTTGTAAGTGAAGAGGGTGCTTCTCTCCATTTAAAAGC
AGGTGCTAAAAGAGTAATTATTTCCGCACCCGCTAAAGAAAAAACTATCA
GGACAGTTGTTTACAATGTTAATCACAAAACCATTAGTAGCGATGATAAG
ATCATCTCAGCAGCTAGCTGTACTACTAACTGTTTAGCACCATTAGTTCA
TGTACTTGAAAAGAACTTTGGGATTGTTTATGGAACGATGCTAACAGTTC
ATGCATATACTGCAGATCAACGCTTACAAGATGCTCCTCATAATGACTTA
CGTCGTGCTCGTGCTGCAGCTGTTAACATTGTGCCAACAACAACAGGAGC
AGCTAAAGCAATTGGGCTTGTTGTTCCAGAAGCAAATGGCAAACTTAATG
GGATGTCACTCCGTGTTCCAGTGTTAACTGGTTCTATTGTAGAGTTAAGT
GTTGTACTTGAAAAAAGTCCATCTGTTGAACAAGTAAATCAAGCCATGAA
GCGATTTGCTTCCGCTTCTTTTAAATATTGTGAAGATCCTATTGTATCTA
GCGATGTGGTAAGTTCTGAATATGGTTCAATTTTCGATTCTAAACTAACC
AATATTGTTGAAGTTGATGGCATGAAACTTTATAAGGTGTATGCATGGTA
TGATAATGAATCTTCCTATGTACACCAACTAGTGAGAGTAGTTAGCTATT
GTGCTAAGCTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy