Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR220 IGR222 IGR223 IGR224 IGR221 pta, - MG299 ftsY, - MG297 glnQ_2, - MG303 pgk, - MG300 hsp70,dnaK, - MG305 p115, - MG298 pta, - MG299 ftsY, - MG297 glnQ_2, - MG303 pgk, - MG300 hsp70,dnaK, - MG305 p115, - MG298 Type: inverted, Name:  - 63 pta, - MG299 ftsY, - MG297 glnQ_2, - MG303 pgk, - MG300 hsp70,dnaK, - MG305 p115, - MG298 cbiO, - MG304 MG302 gap, - MG301 cbiO, - MG304 MG302 gap, - MG301
* Calculated from Protein Sequence

Gene ID: MG300

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgk  

Definition:
phosphoglycerate kinase

Gene Start:
370962

Gene Stop:
369715

Gene Length:
1248

Molecular Weight*:
45336

pI*:
9.62

Net Charge*:
8.79

EC:
2.7.2.3  

Functional Class:
Energy metabolism; Glycolysis and Gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Energy Metabolism; Methane metabolism

Comment:
From Prosite PDOC00102:

Phosphoglycerate kinase (EC 2.7.2.3)(PGK) catalyzes the second step in the second phase of glycolysis, the reversible conversion of 1,3-diphospho-glycerate to 3-phosphoglycerate with generation of one molecule of ATP. PGK is found in all living organisms and its sequence has been highly conserved throughout evolution. It is a two-domain protein; each domain is composed of six repeats of an alpha/beta structural motif.

Reference: Biochem. Soc. Trans. 1990 (18):187-190.

In B.subtilis, this protein is the first in a large operon coding for glycolytic enzymes along with (in order), tpi, pgm and eno. See gene records UU181 (tpi), UU182 (pgm) and UU184 (eno) for the other glycolytic genes.


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to phosphoglycerate kinase
sequences, e.g. residues 6-414 are 69% similar to PGK_MYCPN.
MG300 is similar to T.pallidum TP0538, a predicted
phosphoglycerate kinase. It is also similar to C.trachomatis
phosphoglycerate kinase sequences CT693.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0126 is ehgpcmy.
COG name: 3-phosphoglycerate kinase.
Functional Class: C
BeTs to h,g,c,m,y.

Blocks Summary:  Blocks Search
Residues 16-412 represent 14 matches to blocks BL00111A-I
(Phosphoglycerate kinase proteins).

ProDom Summary:  Protein Domain Search
Residues 20-89, 90-406 constitute defined domains of
PGK_MYCGE, residues 363-409 of PGK_PLAFA support this
assignment.


Paralogs:  Local Blast Search
No evidence of paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 6 to 415 (E-value = 1.8e-144) place MG300 in the PGK family which is described as Phosphoglycerate kinase (PF00162)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
43  
126
non-globular  
188  
305

PDB Hit:
gi|3318871|pdb|1VPE| Crystallographic Analysis Of Phosphoglycerate Kinase From The Hyperthermophilic Bacterium Thermotoga Maritima Transferase, Phosphoglycerate Kinase, Thermotoga Maritima, Hyperthermostability, Crystal, Amp-Pnp, 3-Pga Mol_id: 1; Molecul

Gene Protein Sequence:
VLSSNMLNFKTLQAIDFQNKTVVLRSDFNVPMINGVISDSERILAGLDTI
KFLVKKNCKIVLLSHLSRIKSLEDKLNNKKSLKPVAELLQQLLPTVKVQF
SCKNTGAEVKQKVQALAFGEILLLENTRYCDVNDKGEIVKLESKNDPELA
KFWASLGEIFVNDAFGTAHRKHASNAGIAKYVAKSCIGFLMEKELKNLSY
LIQSPQKPFVVVLGGAKVSDKLKVVENLLKLADNILIGGGMVNTFLKAKG
KATANSLVEKELIDVAKQILDKDTHNKIVLAIDQVMGSEFKDQTGITLDV
SDKIQEQYQSYMSLDVGSKTIALFESYLKTAKTIFWNGPLGVFEFTNFAK
GTSKIGEIIAKNKTAFSVIGGGDSAAAVKQMQLSDQFSFISTGGGASLAL
IGGEELVGISDIQKNS

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTAAGCTCTAATATGCTTAATTTCAAAACACTCCAAGCAATTGATTT
TCAAAACAAAACCGTTGTTTTAAGAAGTGATTTTAATGTCCCAATGATCA
ATGGGGTTATTAGTGATAGTGAAAGAATTTTAGCTGGTTTGGATACTATT
AAGTTCTTAGTTAAAAAGAACTGCAAGATAGTGCTACTATCACACCTTTC
AAGGATTAAGAGTTTAGAAGATAAACTAAACAACAAAAAATCTTTAAAGC
CGGTTGCTGAATTACTCCAACAACTCTTACCAACTGTAAAGGTTCAATTT
TCTTGTAAAAACACTGGTGCTGAAGTTAAACAAAAAGTGCAAGCATTAGC
ATTCGGTGAAATCCTTCTCCTTGAAAACACTCGCTATTGTGATGTAAACG
ATAAAGGAGAAATTGTTAAATTAGAAAGTAAAAATGATCCTGAACTAGCG
AAATTCTGGGCTAGTTTAGGGGAAATTTTTGTTAATGATGCATTTGGTAC
TGCCCATAGAAAACATGCTTCTAATGCAGGAATTGCAAAGTATGTTGCAA
AATCCTGTATTGGGTTTTTAATGGAAAAAGAACTAAAGAACCTCTCTTAC
CTAATTCAAAGCCCACAAAAACCCTTTGTTGTTGTTTTGGGTGGTGCGAA
AGTATCAGATAAACTAAAGGTAGTTGAAAACTTACTAAAACTTGCTGATA
ATATCTTAATTGGCGGAGGGATGGTAAATACCTTTCTTAAAGCAAAAGGC
AAAGCTACTGCTAATTCCCTAGTTGAAAAAGAGTTAATTGATGTTGCTAA
GCAAATCTTGGATAAAGATACTCATAATAAGATTGTGCTGGCAATTGATC
AGGTAATGGGTTCTGAATTTAAAGATCAAACTGGCATTACTTTAGATGTT
AGTGACAAAATTCAAGAACAATATCAATCCTATATGTCTCTAGATGTTGG
ATCTAAAACAATTGCTTTATTTGAAAGTTATTTAAAAACAGCCAAAACTA
TCTTTTGAAACGGTCCCCTTGGAGTTTTTGAATTTACTAACTTTGCTAAA
GGAACTTCAAAAATCGGTGAGATTATTGCTAAAAATAAAACTGCTTTTAG
CGTTATTGGTGGTGGGGATTCAGCTGCAGCAGTTAAGCAAATGCAACTAT
CTGATCAGTTTAGTTTTATCTCCACTGGTGGTGGTGCTTCTTTAGCACTA
ATTGGTGGGGAAGAGTTAGTAGGTATTAGCGATATTCAAAAAAATTCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy