Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR220 IGR222 IGR223 IGR219 IGR221 MG296 pta, - MG299 ftsY, - MG297 glnQ_2, - MG303 pgk, - MG300 p115, - MG298 MG296 pta, - MG299 ftsY, - MG297 glnQ_2, - MG303 pgk, - MG300 p115, - MG298 Type: inverted, Name:  - 63 MG296 pta, - MG299 ftsY, - MG297 glnQ_2, - MG303 pgk, - MG300 p115, - MG298 cbiO, - MG304 MG302 gap, - MG301 cbiO, - MG304 MG302 gap, - MG301
* Calculated from Protein Sequence

Gene ID: MG299

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pta  

Definition:
phosphate acetyltransferase

Gene Start:
369694

Gene Stop:
368735

Gene Length:
960

Molecular Weight*:
35456

pI*:
7.48

Net Charge*:
1.08

EC:
2.3.1.8  

Functional Class:
Central intermediary metabolism  
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Carbohydrate Metabolism; Pyruvate metabolism

Comment:
This enzyme catalyzes the formation of acetyl phosphate and CoA from acetyl-CoA and orthophosphate.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to phosphotransacetylase sequences, e.g. residues
1-320 are 77% similar to PTA_MYCPN. Residues 5-319 are 42% similar to
PTA_BACSU. Residues 1-318 are 31% similar to TP0094, a predicted phosphate acetyltransferase sequence from T.pallidum.
No similarities are present for C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0280 is ehgpc-- .
COG name: Phosphotransacetylase.
Functional Class: C
BeTs to h,g,c.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-71, 100-227, 228-288, 289-317 constitute defined domains of PTA_MYCGE.
Residues 5-94 are 34% similar to a domain of PTA_BACSU.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 2 to 315 (E-value = 2.9e-173) place MG299 in the PTA_PTB family which is described as Phosphate acetyl/butaryl transferase (PF01515)

PDB Hit:


Gene Protein Sequence:
MSVIDIFKKRLQAVSKKPVIIFPEGWSASVLKAVEMLNESKLIQPAVIFH
NRQEIPANFDKKITHYVIDEMDLTSYANFVYEKRKHKGMDLKEAQKFVRD
PSSLAATLVALKVVDGEVCGKEYATKDTLRPALQLLATGNFVSSVFIMEK
GEERLYFTDCAFAVYPNSQELATIAENTFNFAKSLNEDEIKMAFLSYSTL
GSGKGEMVDKVVLATKLFLEKHPELHQSVCGELQFDAAFVEKVRLQKAPQ
LTWKNSANIYVFPNLDAGNIAYKIAQRLGGYDAIGPIVLGLSSPVNDLSR
GASVSDIFNVGIITAAQAIK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGTTATTGATATTTTTAAAAAACGATTACAAGCTGTTAGTAAAAA
ACCTGTAATTATCTTTCCAGAAGGTTGATCAGCAAGTGTTTTAAAAGCAG
TTGAAATGCTTAATGAATCTAAGCTGATCCAACCTGCAGTTATCTTTCAT
AATCGTCAGGAAATCCCTGCAAATTTTGATAAAAAAATAACTCATTATGT
GATTGATGAGATGGATTTAACTAGCTATGCTAACTTTGTCTATGAAAAAC
GTAAGCATAAGGGGATGGATTTAAAAGAAGCACAAAAGTTTGTACGTGAT
CCTAGTTCTTTAGCTGCTACCTTAGTTGCTCTAAAGGTTGTTGATGGTGA
GGTTTGTGGTAAAGAATATGCTACAAAAGATACTTTAAGACCAGCTTTAC
AGTTACTAGCAACTGGTAATTTTGTTTCTAGTGTTTTCATCATGGAAAAA
GGTGAAGAACGTTTGTACTTCACTGATTGTGCTTTTGCTGTTTATCCTAA
CTCCCAAGAGTTAGCAACAATTGCTGAAAACACCTTCAATTTTGCCAAAA
GTTTAAATGAGGATGAGATAAAAATGGCTTTTTTAAGCTATTCAACGCTT
GGCAGTGGTAAGGGTGAAATGGTGGATAAAGTTGTTTTAGCAACTAAACT
ATTTTTAGAAAAACACCCTGAATTGCATCAAAGTGTTTGTGGTGAGCTCC
AGTTTGATGCTGCTTTTGTTGAAAAGGTTAGGTTACAAAAAGCACCTCAA
CTAACTTGAAAAAATAGTGCTAATATCTATGTTTTTCCTAATTTAGATGC
TGGTAACATTGCTTATAAAATCGCCCAAAGACTTGGAGGGTATGATGCAA
TTGGTCCTATTGTTCTTGGACTTTCAAGTCCAGTGAATGATCTTTCAAGG
GGAGCTAGTGTCAGTGACATTTTTAATGTTGGAATTATCACTGCCGCTCA
AGCAATTAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy