Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR218 IGR220 IGR216 IGR217 IGR219 MG296 ftsY, - MG297 MG295 MG294 alaS, - MG292 p115, - MG298 MG296 ftsY, - MG297 MG295 MG294 alaS, - MG292 p115, - MG298 MG296 ftsY, - MG297 MG295 MG294 alaS, - MG292 p115, - MG298 glpQ, - MG293 glpQ, - MG293
* Calculated from Protein Sequence

Gene ID: MG295

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
probable tRNA (5-methylaminoethyl-2-thiouridylate)-methyltransferase

Gene Start:
364022

Gene Stop:
362922

Gene Length:
1101

Molecular Weight*:
41875

pI*:
9.96

Net Charge*:
15.36

EC:
2.1.1.61  

Functional Class:
Translation; tRNA modification  

Pathway: pathway table

Comment:
In E.coli, this enzyme modifies tRNA to contain 5-methylaminomethyl-2-thiouridylate.

Blast Summary:  PSI-Blast Search
Numerous hits to tRNA methyltransferases and to hypothetical proteins:
residues 6-367 are 63% similar to TRMU_MYCPN. Residues 1-367 are 37% similar to TRMU_ECOLI.
Residues 65-367 are 37% similar to CT187, a predicted ATPase in C.trachomatis.
No similarities are seen to T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0482 is ehgpc-y.
COG name: Predicted ATPase of the PP-family.
Functional Class: R
BeTs to e,g,c,y.


Blocks Summary:  Blocks Search
Residues 7-26 are matched to block BL01263B, uncharacterized protein, e.g.
YB57_METJA.

ProDom Summary:  Protein Domain Search
Residues 6-265 and 266-367 constitute defined domains of Y295_MYCGE. Residues
269-367 are 32% similar to a domain of YCFB_ECOLI.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 6 to 367 (E-value = 1.4e-215) place MG295 in the tRNA_Me_trans family which is described as tRNA methyl transferase (PF03054)

PDB Hit:


Gene Protein Sequence:
MSIIAKTVFIGLSGGVDSAVSALLLKKQYQEVIGVFMECWDETLNNDFYG
HKKINNNKSGCSSFQDFQQAKKIANSLGIKLIKKNLIEAYWNKVFLPMIQ
SFKKGLTPNPDIWCNRFIKFGLLHDFCKQINPNSLFATGHYAKINMIENQ
PLLSIPKDTNKDQTYFLANVKKEQFQNVIFPLADLKKITVRNIARENNWE
VADKKDSTGICFIGERHFSDFLKNYLPVKKGLIKDWKTKQTISEHDGVWF
YTIGQRSGLNLGGLKQRHFVVAKDIETNELFVSCDKEELLKTTILLDQFN
WLYTPKQLPSQVLVRIRHAQKPEIAKLKLLSDNKLEITFKNPVISVASGQ
FGVLYTLDQICLGAGLI

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAATTATTGCAAAAACAGTTTTTATAGGTTTAAGCGGTGGTGTTGA
TTCTGCTGTTAGTGCTTTACTTTTAAAAAAGCAATACCAAGAAGTTATTG
GTGTTTTTATGGAATGTTGGGATGAGACACTTAATAATGATTTTTATGGT
CATAAGAAAATAAATAATAACAAATCAGGTTGTTCATCTTTTCAAGACTT
CCAACAGGCTAAAAAAATCGCTAATTCTTTAGGAATTAAGTTAATAAAAA
AAAACTTAATTGAAGCTTATTGAAACAAAGTTTTTTTACCTATGATTCAA
AGTTTCAAAAAAGGGTTAACCCCAAATCCAGACATCTGGTGTAATCGTTT
TATTAAGTTTGGTTTATTGCATGATTTTTGTAAGCAAATTAACCCTAATT
CTCTTTTTGCAACTGGTCATTATGCCAAAATAAACATGATAGAAAATCAG
CCTTTGCTTTCTATTCCTAAAGATACCAATAAAGATCAAACTTATTTTTT
AGCAAATGTTAAAAAAGAACAATTTCAGAATGTTATTTTTCCTTTAGCAG
ATTTAAAAAAAATAACAGTGAGAAATATTGCTAGAGAAAATAATTGAGAA
GTTGCAGATAAAAAAGATTCAACTGGAATTTGTTTTATTGGTGAAAGACA
TTTCAGTGATTTTTTAAAAAACTATTTACCTGTAAAAAAAGGATTAATTA
AGGATTGAAAAACCAAACAAACTATTAGTGAACATGATGGTGTTTGGTTT
TATACGATTGGTCAACGCAGTGGATTAAATTTAGGGGGGTTAAAACAACG
TCATTTTGTTGTTGCTAAGGATATTGAAACTAATGAATTATTTGTTTCTT
GTGACAAAGAAGAATTATTGAAAACAACAATTTTATTGGATCAATTTAAC
TGGTTGTATACACCAAAGCAACTTCCTAGTCAAGTTCTGGTAAGAATTAG
ACATGCTCAAAAACCAGAAATTGCAAAGTTGAAATTATTATCAGATAATA
AACTGGAAATAACATTTAAAAATCCTGTTATAAGTGTTGCATCTGGACAG
TTTGGTGTATTATATACACTTGATCAAATTTGTTTAGGAGCAGGATTAAT
T


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy