Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR218 IGR220 IGR216 IGR217 IGR219 MG296 MG291.1 ftsY, - MG297 MG295 MG294 alaS, - MG292 p115, - MG298 P69_1, - MG291 MG296 MG291.1 ftsY, - MG297 MG295 MG294 alaS, - MG292 p115, - MG298 P69_1, - MG291 MG296 MG291.1 ftsY, - MG297 MG295 MG294 alaS, - MG292 p115, - MG298 glpQ, - MG293 glpQ, - MG293 P69_1, - MG291
* Calculated from Protein Sequence

Gene ID: MG293

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glpQ  

Definition:
probable glycerolphosphoryl diester phosphodiesterase

Gene Start:
361384

Gene Stop:
360653

Gene Length:
732

Molecular Weight*:
28898

pI*:
9.58

Net Charge*:
6.83

EC:
3.1.4.46  

Functional Class:
Fatty acid and phospholipid metabolism; Degradation  

Pathway: pathway table
Glycerolipid metabolism
Phospholipid degradation

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypothetical proteins in bacteria, e.g. residues
1-241 are 66% similar to Y293_MYCPN. Residues 4-235 are 33% similar to Y385_MYCPN.
Residues 7-218 are 34% similar to a hypothetical protein from B.subtilis (Y14082).
Weaker matches to glycerolphosphoryl diester phosphodiestease sequences, e.g.
residues 6-225 are 29% similar to GLPQ_BACSU.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0584 is ehgp--y.
COG name: Glycerophosphoryl diester phosphodiesterase.
Functional Class: C
BeTs to e,g,y.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 10-61, 62-93, 94-114, 115-134, 135-234 constitute defined domains of Y293_MYCGE.

Paralogs:  Local Blast Search
MG293 is paralogously related to MG385, a hypothetical coding region: residues
4-234 are 36% similar to this protein.

Pfam Summary:  Pfam Search
Residues 10 to 236 (E-value = 1.3e-65) place MG293 in the GDPD family which is described as Glycerophosphoryl diester phosphodiesterase family (PF03009)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
36  
180

PDB Hit:


Gene Protein Sequence:
MHNKQLLLAHRGYSFIAPENTKLAFDLAFEYCFDGIELDVHLTKDEQLVI
IHDETTLRTALVNKEVEFESLVSLKRDDHSAFFHLKIQFQSILTLKEFLD
LYLDKFKLINIEIKTDQKPYLGIEKKLVDLVKGYGKKAIDKILFSSFNFE
SLQKVYDLDNSYKKGFLFWTKKQFETISTARIQKICQFLHPWTKIYEKYP
QMIKKLNLPLNLWTVNSQNKFQQFLADNHVYAQIANKKFEIKIN

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATAACAAGCAATTGCTTTTAGCACATAGGGGTTATTCATTCATTGC
TCCAGAAAACACCAAACTAGCATTTGATTTAGCTTTTGAATATTGTTTTG
ATGGAATAGAGCTTGATGTTCATTTAACTAAAGATGAACAGTTAGTTATC
ATTCATGATGAGACAACATTGAGAACCGCATTAGTTAATAAGGAGGTTGA
GTTTGAATCATTAGTTAGTTTAAAAAGAGATGATCATAGTGCTTTTTTTC
ACCTTAAAATTCAATTTCAATCGATCCTAACTTTAAAAGAGTTCTTAGAT
CTTTATTTAGATAAATTTAAGTTAATCAATATTGAGATTAAAACTGATCA
AAAACCATATTTAGGAATTGAAAAGAAGCTTGTTGACCTAGTTAAAGGTT
ATGGTAAAAAAGCAATAGATAAGATCTTGTTTTCATCCTTTAACTTTGAA
TCTTTGCAAAAAGTTTATGATTTAGATAATAGTTACAAAAAAGGTTTTTT
ATTTTGGACTAAAAAACAGTTTGAAACAATTAGTACAGCTAGAATCCAAA
AGATTTGTCAATTCCTCCACCCATGAACCAAAATATATGAAAAGTATCCC
CAAATGATCAAAAAACTTAACTTACCTTTAAATTTATGAACAGTAAACAG
TCAAAATAAGTTTCAGCAGTTCTTAGCTGATAATCATGTTTATGCACAAA
TTGCTAACAAAAAGTTTGAAATAAAAATAAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy