Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR218 IGR216 IGR217 MG296 MG291.1 MG295 MG294 alaS, - MG292 MG289 P69_1, - MG291 MG296 MG291.1 MG295 MG294 alaS, - MG292 MG289 P69_1, - MG291 MG296 MG291.1 MG295 MG294 alaS, - MG292 glpQ, - MG293 glpQ, - MG293 MG289 P69_1, - MG291 MG290 MG290
* Calculated from Protein Sequence

Gene ID: MG292

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
alaS  

Definition:
alanyl-tRNA synthetase

Gene Start:
360592

Gene Stop:
357893

Gene Length:
2700

Molecular Weight*:
104296

pI*:
8.59

Net Charge*:
11.23

EC:
6.1.1.7  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Alanine and Aspartate metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to alanyl-tRNA synthetase sequences: residues
1-896 are 65% similar to SYA_MYCPN. Residues 6-442 and 568-704 are 33% and 29% similar to TP1017, a predicted ala-tRNA ligase from T.pallidum.
MG292 residues 5-711 are 32% similar to CT749, a predicted ala-tRNA ligase
from C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0013 is ehgpcmy.
COG name: Alanyl-tRNA synthetase.
Functional Class: J
BeTs to hgcmy.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 5-700 and 713-900 constitute defined domains of SYA_MYCGE. Residues
481-874 are 25% similar to a domain of YNE0_YEAST. Residues 550-683 are 24% similar to
a domain of SYT_SYNY3. Residues 768-811 are similar to a domain of SYAC_YEAST.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
316  
361
coil-coil  
606  
633
coil-coil  
706  
750
coil-coil  
763  
790
non-globular  
792  
900

PDB Hit:


Gene Protein Sequence:
MNWTTDKVRQTWLDYFAKKDHLVLASKSLIPINDPSLLWINSGVATLKDY
FSARKTPPSKRLVNAQICLRVNDIENVGFTSRHQTLFEMLGNFSIGDYFK
TEAIDFAFDLLVNYYQLDPKRFYITVYEDDETTYKRWIKHKIDKNHIIKC
DKSRNFWDLGLGPCGPCTEIYYDRGEKFDPKKIGEKLFFEDIENDRYVEI
WNIVFSQFNNDGNGNYTELAQKNIDTGAGIERLVSVLQNSPTNFDTDIFL
KLIKIIEAFCPFKYDPNSYFTFDPQKVKEQSYFRIIADHFKAITFTISEG
VLPGPNERNYVVRRLLRRALIACKKLQLNLAFIEKIIDEIIASYENYYQH
LKAKNETVKQVVLKEINAFNKTIDLGLVLFEKSVKNNTLTPQLTFQLNET
YGFPVEIIRELVNQKGLTIDWTVFDQLMAKHRSISKQNNQTINFEKQNIN
LVNFKTKSTFFYHKNKINAKVIGLFDENYLPVKELNNQSGYVVFDQTVLY
ATSGGQRYDEGSCINHSNNNDQKISFQGVFKGPNKQHFHYFLVGSFKLND
QVTLSHDETWRKLAANNHSLEHLLHAALQKEIDPLIKQSGAFKSAQKATI
DFNLNRHLTRNELEKVENKIRSLIKQKISSKEIFTDFEGSQKLNAIAYFE
EEYSQHEILRVIRFGDYSVELCGGTHVANTASIEDCFITDFYSLGAGRWR
IEIISSNETINNYLKAENQKLIQLKSELEKVLSLIDSSIFKVELKELQQR
LDKFILPEKITQLRDASDTLLALKNDINQLKTKNYKVSQQALALSIKKQL
LSLVDENKSYVIATFNDVEPKLLLQTLHDVFNQNQTKNFLIINQFNESNS
FIVIGNKTTTIIEKLRNSFNLKGGGNDKLFRGSFQDNVTPQKLNELFQNK


Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTGAACAACTGATAAAGTAAGGCAAACCTGATTAGATTATTTTGC
AAAGAAAGACCATCTGGTTTTAGCTTCAAAATCACTAATTCCGATCAACG
ACCCATCATTATTATGAATCAATTCAGGAGTTGCTACTTTAAAAGATTAT
TTCAGTGCTAGAAAAACACCACCATCTAAACGCCTTGTTAATGCACAGAT
ATGTTTAAGGGTAAATGATATTGAAAATGTGGGTTTTACTTCAAGACATC
AAACTTTGTTTGAGATGCTTGGAAATTTTTCAATCGGTGATTATTTTAAA
ACAGAAGCAATTGATTTTGCTTTTGATCTTTTAGTTAATTATTATCAGCT
AGATCCTAAGCGTTTTTATATCACTGTTTATGAAGATGATGAAACTACTT
ATAAAAGATGAATTAAGCATAAAATTGATAAAAATCACATTATTAAGTGT
GACAAAAGTCGTAACTTTTGAGACTTAGGTTTAGGACCTTGTGGACCTTG
CACTGAAATCTATTATGATCGTGGTGAGAAATTTGATCCTAAAAAAATTG
GTGAAAAACTTTTCTTTGAGGACATTGAAAATGATCGTTATGTTGAGATA
TGAAACATTGTTTTTAGTCAATTTAATAATGATGGTAATGGCAACTATAC
AGAACTTGCTCAAAAAAATATTGATACAGGTGCTGGAATAGAAAGACTTG
TTTCAGTATTACAAAATAGTCCAACCAATTTTGATACTGACATCTTTTTA
AAGCTAATCAAAATAATTGAAGCTTTTTGTCCATTTAAATATGATCCCAA
CTCTTACTTTACATTCGATCCTCAAAAAGTGAAAGAACAGAGTTATTTTC
GGATTATTGCTGATCACTTTAAAGCAATCACTTTTACCATTTCAGAAGGA
GTTTTACCTGGTCCTAATGAGAGAAATTATGTAGTAAGAAGACTTTTAAG
ACGTGCTTTAATAGCTTGTAAGAAATTGCAATTAAACTTAGCATTTATTG
AAAAGATAATAGATGAAATCATCGCTTCATATGAGAATTATTATCAACAT
TTAAAAGCTAAAAATGAAACTGTTAAACAGGTAGTTTTAAAAGAGATTAA
TGCATTTAATAAAACGATTGATTTAGGTTTAGTGCTGTTTGAAAAAAGTG
TTAAAAACAATACTCTAACTCCCCAATTAACATTTCAATTGAACGAAACA
TACGGTTTTCCTGTTGAAATAATAAGAGAACTAGTTAATCAAAAAGGTTT
AACTATTGATTGAACAGTATTTGATCAGTTAATGGCCAAACATCGTTCTA
TCTCTAAGCAAAATAACCAAACTATAAATTTTGAAAAACAAAATATTAAT
TTAGTTAATTTCAAAACTAAAAGTACTTTTTTTTATCACAAAAATAAAAT
TAATGCTAAGGTAATTGGTCTTTTTGATGAAAATTATTTACCAGTTAAAG
AACTTAATAATCAAAGTGGTTATGTAGTTTTTGACCAAACAGTTTTATAT
GCTACTTCTGGAGGACAGAGATATGATGAAGGAAGTTGCATTAATCATTC
TAATAATAATGATCAAAAAATCAGTTTTCAAGGTGTATTTAAAGGACCTA
ATAAACAACACTTCCACTACTTTTTAGTAGGTAGTTTTAAACTCAATGAT
CAAGTAACTTTATCACATGATGAAACTTGAAGAAAACTTGCTGCTAACAA
CCATAGTTTAGAACACCTTTTACATGCAGCTTTACAAAAAGAAATTGATC
CACTTATTAAACAAAGTGGTGCTTTTAAATCTGCGCAAAAAGCAACTATT
GACTTTAATTTGAATCGTCATTTAACAAGAAATGAACTTGAGAAAGTAGA
AAATAAAATTCGCTCTTTGATTAAACAAAAAATAAGCTCAAAAGAGATTT
TTACTGATTTTGAAGGGAGTCAAAAACTAAATGCAATTGCTTATTTTGAA
GAGGAATATTCTCAACATGAAATATTAAGAGTGATCCGCTTTGGTGATTA
TAGTGTTGAGTTGTGTGGTGGCACTCATGTAGCTAACACTGCTTCAATTG
AAGATTGTTTTATTACTGATTTCTATTCTTTAGGAGCTGGAAGATGAAGG
ATTGAAATCATTAGCAGTAATGAAACTATTAACAACTATTTAAAAGCAGA
AAATCAAAAATTAATCCAATTAAAATCAGAACTTGAAAAAGTTCTATCTT
TGATTGATAGTTCAATTTTTAAAGTTGAGTTAAAAGAATTGCAACAAAGG
CTAGATAAATTTATCTTACCTGAAAAAATTACCCAATTAAGAGATGCATC
TGATACTTTATTAGCTTTAAAAAATGATATTAACCAGTTAAAAACAAAAA
ACTATAAAGTATCACAGCAAGCTTTAGCTTTATCAATTAAAAAGCAATTA
TTATCCTTAGTAGATGAAAATAAAAGTTATGTAATTGCCACTTTTAATGA
CGTAGAACCTAAACTATTGCTACAAACACTACATGATGTTTTCAATCAAA
ATCAAACTAAAAATTTCTTGATAATTAATCAATTCAATGAAAGTAATTCA
TTTATTGTTATAGGAAATAAAACTACCACCATTATTGAAAAATTAAGAAA
TAGTTTTAATTTAAAGGGCGGAGGCAATGATAAGTTATTTAGAGGTTCTT
TTCAGGATAATGTTACCCCTCAAAAGCTTAATGAATTGTTTCAAAATAAA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy