Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-2 tRNA-Trp-2 tRNA-Lys-1 tRNA-Gln-1 tRNA-Leu-1 tRNA-Tyr-1 IGR211 IGR212 IGR207 IGR210 IGR209 IGR208 IGR213 greA, - MG282 MG280 MG281 acp, - MG287 MG286 MG285 proS, - MG283 greA, - MG282 MG280 MG281 acp, - MG287 MG286 MG285 proS, - MG283 Type: direct, Name:  - 33 Type: direct, Name:  - 21 Type: inverted, Name:  - 56 Type: direct, Name:  - 29 Type: direct, Name:  - 30 Type: direct, Name:  - 34 greA, - MG282 MG280 MG281 MG279 MG279 acp, - MG287 MG286 MG285 proS, - MG283 MG284 MG284
* Calculated from Protein Sequence

Gene ID: MG283

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
proS  

Definition:
prolyl-tRNA synthetase

Gene Start:
345181

Gene Stop:
346629

Gene Length:
1449

Molecular Weight*:
55858

pI*:
9.21

Net Charge*:
13.42

EC:
6.1.1.15  

Functional Class:
Translation; Aminoacyl-tRNA synthetases  

Pathway: pathway table
Amino Acid Metabolism; Arginine and proline metabolism
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
See Prosite PDOC00363.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to prolyl-tRNA synthetase sequences: residues
1-483 are 65% similar to SYP_MYCPN. Residues 1-483 are 32% similar to the enzyme from
B.burgdorferi (AE001145). MG283 is similar to CT393, of C.trachomatis, and to TP0160 of T.pallidum, both predicted prolyl-tRNA
synthetases.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0442 is ehgpcmy.
COG name: Prolyl-tRNA synthetase.
Functional Class: J
BeTs to g,m.y.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 1-90, 91-116, 117-141, 142-191, 203-302,303-483 constitute defined domains
of SYP_MYCGE. Residues 4-52 are 30% similar to a domain of YH10_YEAST.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 29 to 206 (E-value = 1.8e-27) place MG283 in the tRNA-synt_2b family which is described as tRNA synthetase class II core domain (G, H, P, S and T) (PF00587)
Residues 302 to 392 (E-value = 5.9e-08) place MG283 in the HGTP_anticodon family which is described as Anticodon binding domain (PF03129)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
401  
431

PDB Hit:


Gene Protein Sequence:
MTKKTQDLTSWYDQLLVKAKLICHGEVKGTVCFLNNSWGLWMEIQQLYND
AIANKNQLSAIALTKFQPTTSFCYQVFQVQLPTLSFYSEYQKEKTHIKGF
NPELFLINQVGQKQLNDPLVLRPTSEIAFCNLWKKQELSYHDLPLIYNQW
TQVFRAEKNTRPFLRNSEFYWQETHGLFVDQSQSEQAAISFWNLYQDLII
NKLCIPAFVGLKSESEKFAGAKNTWTIEAIMPDGQSLQCATSHDLGDTFT
KSFTISYQSKTNQKMTPSSFSCGMSTRILGAIFLTHSDDYGLVLPWYLAS
KQVKLYLFDKNNNPKTRALAFLVKDFLEKLKIRFSFIEINNQLGKQLLKG
EIEGIPLQMIVDNEKTINIFNRLTRLKTSLTFANLQTEFVNLVNNYHTEM
YRKANDLVEQKLARVQTLKEIEQAFKNKKAVLCTVKLTGELEQHLKTKYQ
VSVRCVFKKSDVTQNCPFTNQPCFDSVLIARAY

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAAAAAAAACACAAGATCTCACTAGTTGGTATGACCAACTGCTAGT
TAAAGCAAAGTTAATTTGTCATGGTGAAGTTAAAGGTACAGTTTGTTTTT
TAAATAACAGTTGAGGCTTATGGATGGAAATCCAACAGCTTTACAATGAT
GCAATTGCAAATAAAAATCAATTGTCTGCAATTGCTCTAACTAAATTCCA
ACCAACTACTAGTTTTTGTTATCAAGTATTCCAAGTACAACTCCCTACCC
TTTCTTTTTACAGTGAATATCAAAAGGAAAAAACCCATATCAAAGGTTTT
AATCCTGAGCTTTTTTTAATTAATCAAGTTGGTCAAAAACAACTCAATGA
TCCTTTGGTTTTACGACCTACTAGTGAGATTGCTTTTTGCAACTTATGGA
AAAAACAAGAGTTATCTTACCATGATCTACCTTTAATTTATAACCAGTGA
ACTCAGGTTTTTCGTGCAGAAAAAAACACCAGACCTTTTTTGAGAAACAG
TGAGTTTTACTGACAAGAAACTCATGGGCTTTTTGTGGATCAGAGCCAAT
CTGAACAAGCTGCTATTAGCTTTTGAAATTTATATCAGGATTTAATTATT
AACAAACTTTGTATCCCTGCTTTTGTTGGTTTGAAAAGTGAAAGTGAAAA
ATTTGCAGGTGCTAAAAACACATGGACAATAGAAGCAATTATGCCTGATG
GACAAAGTTTACAATGTGCCACTAGCCATGATTTAGGTGACACTTTTACA
AAGAGTTTTACTATCAGCTATCAGAGTAAAACTAACCAAAAAATGACTCC
AAGTAGTTTTAGTTGTGGGATGTCAACTAGGATCTTAGGAGCAATTTTTT
TAACCCACAGCGATGATTATGGTTTGGTTTTACCTTGGTATCTAGCAAGT
AAACAAGTCAAGTTATACCTGTTTGATAAAAACAATAACCCTAAAACAAG
AGCTTTAGCTTTTTTAGTGAAGGATTTTTTAGAAAAACTCAAAATTCGCT
TTAGTTTTATAGAAATTAACAATCAACTAGGTAAACAACTTTTAAAAGGA
GAAATAGAAGGTATTCCATTACAGATGATTGTTGATAATGAAAAAACTAT
TAACATCTTCAACCGCTTAACACGTTTAAAAACCAGCTTAACATTTGCAA
ATCTCCAAACTGAATTTGTTAATTTAGTTAACAACTACCATACAGAGATG
TATAGAAAAGCAAATGATTTAGTTGAACAAAAACTAGCAAGAGTACAAAC
TTTAAAGGAAATTGAACAAGCATTCAAAAATAAAAAGGCTGTTTTATGTA
CCGTGAAGTTAACTGGTGAACTTGAACAACACTTAAAGACAAAATACCAA
GTTAGTGTTAGGTGTGTTTTTAAAAAGTCAGATGTAACACAAAACTGTCC
TTTTACAAATCAACCTTGTTTTGATTCAGTTTTAATTGCACGTGCTTAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy