Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-2 tRNA-Lys-1 tRNA-Gln-1 tRNA-Leu-1 tRNA-Tyr-1 IGR206 IGR204 IGR205 IGR203 IGR207 IGR208 greA, - MG282 apt, - MG276 MG280 nox, - MG275 MG281 MG277 spoT, - MG278 greA, - MG282 apt, - MG276 MG280 nox, - MG275 MG281 MG277 spoT, - MG278 Type: inverted, Name:  - 56 greA, - MG282 apt, - MG276 MG280 nox, - MG275 MG281 MG277 MG279 MG279 spoT, - MG278
* Calculated from Protein Sequence

Gene ID: MG278

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
spoT  

Definition:
guanosine-3',5'-bis(diphosphate) 3'- pyrophosphohydrolase

Gene Start:
338366

Gene Stop:
340525

Gene Length:
2160

Molecular Weight*:
84132

pI*:
10.06

Net Charge*:
29.77

EC:
3.1.7.2  

Functional Class:
Regulatory functions  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism

Comment:
The spoU gene of escherichia coli, the fourth gene of the spoT operon, is essential for tRNA (Gm18) 2 ' -O -methyltransferase activity. Reference Author: Persson BC, Jager G, Gustafsson C; Reference Location: Nucleic Acids Res 1997;25:4093-409x

See Rockey et al. Microbiol. 142:945 (1996).

Support for this annotation provided by Galperin and Koonin. 1998. Sources of systematic error in functional annotation of genomes: domain rearrangement, non-orthologous gene displacement, and operon disruption. In Silico Biology 1:55-67.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ppGpp hydrolases, kinases, synthetases: residues 1-720
are 71% similar to SPOT_MYCPN, a stringent response protein. Residues 1-708 are
27% similar to a ppGpp synthetase from B.subtilis (U86377). Residues 23-632 are 29% similar to a guanosine-3',5'-bis (diphosphate) sequence from
B.burgdorferi (AE001130). No sinilarities are seen to T.pallidum or C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0317 is ehgpc--.
COG name: Guanosine polyphosphate pyrophosphohydrolases/synthetases.
Functional Class: F
BeTs to e,g,c.


Blocks Summary:  Blocks Search
Residues 388-397 are matched to block BL00710B, concerned with phosphoglucomutase and
related signatures, e.g. MANB_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 39-58, 59-330, 331-353, 354-720 constitute defined domains of SPOT_MYCGE.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 49 to 154 (E-value = 5.5e-12) place MG278 in the HD family which is described as HD domain (PF01966)
Residues 245 to 356 (E-value = 6.9e-59) place MG278 in the RelA_SpoT family which is described as Region found in RelA / SpoT proteins (PF04607)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
97  
127
coil-coil  
202  
236
coil-coil  
473  
522

PDB Hit:


Gene Protein Sequence:
MATIQEIECDFLAKIAQKFTNAEIELINKAFYHAKTWHENQKRLSGEPFF
IHPLRTALSLVEWNMDPITICAGLLHDIIEDTDQTEANIAMIFSKEIAEL
VTKVTKITNESKKQRHLKNKKENLNLKSFVNIAINSQQEINVMVLKLADR
LDNIASIEFLPIEKQKVIAKETLELYAKIAGRIGMYPVKTKLADLSFKVL
DLKNYDNTLSKINKQKVFYDNEWDNFKQQLKKILAQNQIEYQLESRIKGI
YSTYKKLTVHEQNISKIHDLFAIRLITKSELDCYHILGLIHLNFLIDSKY
FKDYIASPKQNLYQSIHTTVRLKGLNVEIQIRTQQMDNVSKFGLASHWIY
KEQKEGLLAPALQLNYLVTKQKHSHDFLKRIFGTDIIKINVSASHEPNVI
KQINVDSNNKLLDIAFENYPKQFAKLTKIEIDGVEINSFDTSVENEMLIE
FYFGKNNNLKSKWIRYMNNPIYREKVKKSLAKLAKSGRYSELAFYEKELG
EKQLKLASETEIQKRLNTLRIKKMSDYLALIECTNFTNDEHLLFLAKNND
KWNKLTKPLKFAFSKVVFHNSYFEQIEGIFITKIVIEPCCSKIPDMPEQV
TGILTKNILSVHRYGCKNLQNKKQLKIIPLYWNIQQLKLKPRKFRSYINI
NGVWSEKTINKICQTIINGDGYIEKIIPKINKQKDEFDLNITLFVNNYQQ
LLTLMDQITTKNISFSWKYL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAACCATTCAGGAAATCGAGTGTGATTTTTTAGCTAAAATAGCACA
AAAATTTACTAATGCAGAGATTGAATTAATTAACAAAGCATTCTATCACG
CTAAAACTTGGCATGAAAACCAGAAACGGCTTAGCGGTGAACCTTTTTTT
ATCCATCCTTTAAGAACGGCATTATCACTAGTTGAATGGAACATGGATCC
TATCACTATTTGTGCTGGTTTGTTACATGACATCATTGAAGATACAGACC
AAACCGAAGCTAATATAGCAATGATTTTTAGCAAAGAAATTGCTGAGCTT
GTCACTAAGGTTACAAAGATTACCAATGAATCTAAAAAGCAACGTCATCT
CAAAAATAAAAAGGAGAATCTTAACTTAAAAAGCTTTGTTAACATTGCAA
TCAATTCTCAACAAGAGATAAATGTAATGGTACTAAAACTAGCAGATCGA
CTTGATAACATCGCTTCCATTGAGTTTCTCCCCATTGAAAAGCAAAAGGT
AATTGCAAAAGAAACTTTAGAACTTTATGCAAAGATTGCTGGGAGGATTG
GGATGTATCCTGTTAAAACAAAATTAGCAGATCTTTCATTTAAGGTGTTG
GATTTAAAAAACTATGATAACACCCTGTCAAAGATTAACAAGCAAAAGGT
CTTTTATGACAATGAGTGGGATAACTTCAAACAACAATTAAAAAAAATCT
TAGCGCAAAATCAGATAGAATACCAACTTGAAAGTCGGATTAAAGGCATT
TACTCTACATATAAAAAACTAACTGTTCATGAACAGAACATCAGTAAGAT
CCATGATCTTTTTGCTATCCGCTTAATTACTAAATCAGAACTTGATTGTT
ATCACATCCTTGGTTTAATTCACCTTAATTTTTTAATTGACAGTAAATAC
TTCAAAGACTATATTGCCTCACCTAAACAAAACCTTTACCAATCAATTCA
TACCACTGTTCGTTTAAAAGGGTTAAATGTTGAGATCCAAATTAGAACCC
AACAGATGGACAATGTTAGTAAGTTTGGCTTAGCTAGTCACTGGATCTAC
AAAGAACAGAAAGAGGGATTGTTAGCACCTGCTTTGCAACTTAATTACCT
AGTGACAAAACAAAAACACTCACATGATTTTCTAAAAAGGATTTTTGGGA
CTGATATTATCAAGATTAATGTTAGTGCTAGTCATGAACCTAATGTAATT
AAGCAAATTAATGTTGATAGCAACAATAAACTCCTTGATATTGCTTTTGA
AAACTATCCCAAGCAATTTGCTAAATTAACCAAAATTGAAATTGATGGGG
TTGAGATCAATTCTTTTGATACTAGTGTTGAAAATGAGATGCTGATTGAA
TTTTACTTTGGCAAGAATAACAATTTGAAATCAAAGTGAATTAGGTATAT
GAATAACCCTATATACCGTGAAAAGGTAAAAAAGAGCTTGGCTAAACTAG
CTAAATCTGGTAGATACAGTGAGTTAGCTTTTTATGAAAAAGAACTGGGT
GAAAAACAGTTAAAACTTGCTAGTGAAACTGAAATCCAAAAACGCTTAAA
CACCCTAAGAATTAAAAAAATGAGTGATTACTTAGCGTTAATTGAGTGTA
CTAACTTTACTAATGATGAACATTTGTTGTTTCTAGCTAAAAACAACGAC
AAGTGAAATAAACTAACAAAACCACTTAAGTTTGCTTTTTCAAAAGTAGT
TTTTCACAACTCTTACTTTGAACAAATTGAAGGTATTTTTATCACCAAAA
TAGTGATTGAACCATGTTGTAGTAAGATCCCTGATATGCCTGAACAAGTA
ACTGGTATCTTAACTAAAAACATTTTAAGTGTTCACCGTTATGGTTGTAA
GAATTTACAAAATAAAAAGCAGTTAAAAATTATCCCGTTATATTGAAATA
TCCAGCAGTTAAAACTAAAACCACGTAAGTTTCGCAGTTACATTAACATT
AACGGAGTGTGGAGTGAAAAAACCATTAATAAAATCTGTCAAACAATTAT
TAATGGTGATGGTTATATTGAAAAAATAATTCCCAAGATCAACAAACAAA
AAGATGAATTTGATTTAAACATCACCCTTTTTGTTAATAACTACCAACAA
CTTCTCACCTTAATGGACCAAATTACCACTAAGAATATCAGCTTTAGTTG
AAAATACCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy