Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR204 IGR201 IGR202 IGR205 IGR203 IGR200 apt, - MG276 pdhB, - MG273 pdhA, - MG274 pdhC, - MG272 nox, - MG275 MG277 spoT, - MG278 apt, - MG276 pdhB, - MG273 pdhA, - MG274 pdhC, - MG272 nox, - MG275 MG277 spoT, - MG278 apt, - MG276 pdhB, - MG273 pdhA, - MG274 pdhC, - MG272 nox, - MG275 MG277 spoT, - MG278
* Calculated from Protein Sequence

Gene ID: MG276

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
apt  

Definition:
adenine phosphoribosyltransferase

Gene Start:
335397

Gene Stop:
334858

Gene Length:
540

Molecular Weight*:
19961

pI*:
9.65

Net Charge*:
5.33

EC:
2.4.2.7  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism

Comment:
Involved in biosynthesis and/or salvage of purines and pyrimidines.

See Prosite PDOC00096.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to adenine phosphoribosyltransferase sequences, e.g.
residues 45-80 are 70% similar to APT_MYCPN. Residues 2-170 are 40% similar
to APT_HUMAN. Residues 8-159 are 39% similar to TP1039, a predicted phosphoribosyltransferase
from T.pallidum. No similarities found to C.trachomatis.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0503 is ehgpcmy.
COG name: Adenine/guanine phosphoribosyltransferases.
Functional Class: F
BeTs to h,g,c,m,y.


Blocks Summary:  Blocks Search
Residues 120-135 are members of block BL00103B (purine/pyrimidine phosphoribosyltransferases)
Residues 54-89 and 112-157 are matched to blocks BL00114C,D, (phosphoribosyl
pyrophosphate synthetases, e.g. KPRS_SYNY3).

ProDom Summary:  Protein Domain Search
Residues 8-104 and 112-161 constitute defined domains of APT_MYCGE. Residues 121-166
are 39% similar to KPRS_MYCPN.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 27 to 167 (E-value = 2.1e-42) place MG276 in the Pribosyltran family which is described as Phosphoribosyl transferase domain (PF00156)

PDB Hit:


Gene Protein Sequence:
MDQNFKLLDQAIKRFENFPNQGTLFYDITPVFSNPQLFNFVLTQMAQFIK
AINAEAIVCPEARGFIFGGALASKTQLPLVLVRKANKLPGQLISASYDLE
YRKHAVLEMSTTSLIQANNAKRCVIVDDVLATAGTVAAIDQLLKQLNGET
VGYCFLIELKKLNGKAKLQPNVVSKILLHY

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCAAAACTTTAAGTTGCTTGATCAAGCAATCAAGCGCTTTGAAAA
TTTTCCCAACCAAGGTACATTGTTTTATGACATTACCCCAGTATTTTCCA
ATCCCCAACTATTTAATTTTGTGCTAACCCAAATGGCACAGTTTATTAAA
GCTATTAATGCAGAAGCGATAGTATGTCCTGAAGCGAGGGGTTTTATCTT
TGGGGGAGCATTAGCTTCTAAAACCCAACTCCCGTTAGTATTGGTTAGAA
AAGCCAATAAACTCCCAGGGCAATTAATTAGTGCTAGCTATGATTTGGAG
TACAGAAAACATGCTGTATTGGAGATGTCAACCACTTCATTAATCCAAGC
TAATAATGCTAAAAGGTGTGTTATTGTTGATGATGTACTTGCCACTGCTG
GAACAGTTGCTGCTATTGACCAATTACTTAAACAGTTAAATGGTGAAACT
GTGGGATATTGCTTTTTAATTGAGCTGAAAAAACTCAATGGTAAAGCTAA
GTTACAACCAAATGTGGTTAGCAAGATTTTATTACATTAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy