Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR199 IGR204 IGR201 IGR202 IGR205 IGR203 IGR200 apt, - MG276 pdhB, - MG273 pdhA, - MG274 pdhC, - MG272 pdhD,dldH, - MG271 nox, - MG275 MG277 spoT, - MG278 apt, - MG276 pdhB, - MG273 pdhA, - MG274 pdhC, - MG272 pdhD,dldH, - MG271 nox, - MG275 MG277 spoT, - MG278 apt, - MG276 pdhB, - MG273 pdhA, - MG274 pdhC, - MG272 pdhD,dldH, - MG271 nox, - MG275 MG277 spoT, - MG278
* Calculated from Protein Sequence

Gene ID: MG275

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nox  

Definition:
NADH oxidase

Gene Start:
334772

Gene Stop:
333339

Gene Length:
1434

Molecular Weight*:
53163

pI*:
8.07

Net Charge*:
5.28

EC:
1.6.-.-  

Functional Class:
Energy metabolism; Aerobic  

Pathway: pathway table
Miscellaneous enzymes

Comment:
NADH oxidase catalyses the four-electron reduction of molecular oxygen to water.

Reaction:
2 NADH + O(2) = 2 NAD(+) + 2 H(2)O.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to NADH oxidases, e.g. residues 1-477 are 83% similar to NAOX_MYCPN.
Residues 3-461 are 38% similar to NAOX_ENTFA. Residues 3-468 are 35% similar to TP0921, a predicted NADH oxidase from T.pallidum.
MG275 is weakly similar to CT557, a predicted lipoamide dehydrogenase E3 component.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0446 is ehgpcmy.
COG name: NAD(FAD)-utilizing dehydrogenases.
Functional Class: R
BeTs to e,g,c,m,y.


Blocks Summary:  Blocks Search
REsidues 3-25, 4-18, 28-41, 169-191, 170-184 are matched to blocks PR00419A,B,D
(adrenodoxin reductase family, e.g. YFFG_ECOLI). Residues 415-435 are matched
to block PR00466C (cytochrome B-245 heavy chain).

ProDom Summary:  Protein Domain Search
Residues 3-91, 108-270, 350-461 constitute defined domains of NAOX_MYCGE.
Residues 326-443 are 33% similar to MERA_BACSR.

Paralogs:  Local Blast Search
MG275 is paralogously related to MG271, a predicted dihydrolipoamide dehydrogenase:
residues 168-443 are 24% similar to this protein.

Pfam Summary:  Pfam Search
Residues 3 to 315 (E-value = 5.3e-58) place MG275 in the Pyr_redox family which is described as Pyridine nucleotide-disulphide oxidoreductase (PF00070)
Residues 352 to 459 (E-value = 3.5e-22) place MG275 in the Pyr_redox_dim family which is described as Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain (PF02852)

PDB Hit:
gi|494414|pdb|1NPX| Nadh Peroxidase (E.C.1.11.1.1) Non-Active Form With Cys 42 Oxidized To A Sulfonic Acid (Cys42-So3h)

Gene Protein Sequence:
MKKVIVIGINHAGTSFIRTLLSKSKDFKVNAYDRNTNISFLGCGIALAVS
GVVKNTDDLFYSNPEELKQMGANIFMSHDVTNIDLIKKQVTVRDLTSNKE
FTDQFDQLVIASGAWPICMNVENKVTHKPLEFNYTDKYCGNVKNLISCKL
YQHALTLIDSFRKDKTIKSVAIVGSGYIGLELAEAAWLCKKQVTVIDLLD
KPAGNNFDHEFTDELEKVMQKDGLKLMMGCSVKGFVVDSTNNVVKGVETD
KGIVNADLVNQSIGFRPSTKFVPKDQNFEFIHNGSIKVNEFLQALNHKDV
YVIGGCAAIYNAASEQYENIDLATNAVKSGLVAAMHIIGSNQVKLQSIVG
TNALHIFGLNLAACGLTEQRAKKLGFDVGISVVDDNDRPEFMGSYDKVRF
KLVYDKKTLRILGAQLLSWNTNHSEIIFYIALAIQKQMLLTELGLVDVYF
LPHYNKPFNFVLATVLQALGFSYYIPKK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAAGTGATTGTGATTGGAATAAATCACGCTGGTACTAGTTTTAT
TAGAACTTTACTTTCAAAAAGTAAGGACTTTAAGGTTAACGCTTATGATA
GAAACACAAACATCTCGTTTCTGGGGTGTGGAATTGCACTTGCTGTTAGT
GGTGTTGTTAAAAACACTGATGATCTTTTCTATTCCAACCCTGAGGAGTT
GAAACAGATGGGCGCTAACATCTTTATGAGTCATGATGTTACTAACATTG
ATCTAATCAAAAAACAGGTAACAGTTAGAGATTTAACATCAAATAAAGAG
TTCACTGATCAGTTTGATCAACTAGTAATCGCTTCAGGAGCATGACCTAT
ATGTATGAATGTTGAAAACAAGGTGACACACAAGCCTTTGGAGTTTAACT
ACACTGACAAATATTGTGGTAATGTTAAGAACTTAATTAGCTGTAAGTTA
TACCAACATGCACTTACCTTAATCGATAGTTTTCGTAAAGATAAAACCAT
TAAATCAGTTGCTATTGTTGGTTCTGGTTACATTGGCTTGGAACTTGCTG
AAGCAGCTTGGTTATGCAAAAAGCAAGTAACAGTAATTGACTTACTTGAT
AAGCCTGCTGGTAATAACTTTGATCATGAGTTTACTGATGAACTTGAAAA
AGTGATGCAAAAAGATGGGTTAAAACTAATGATGGGTTGCAGTGTTAAGG
GCTTTGTTGTTGATAGTACAAACAACGTTGTCAAAGGAGTTGAAACTGAT
AAGGGAATAGTAAATGCAGACCTTGTGAACCAATCAATTGGGTTTAGACC
TAGCACTAAGTTTGTTCCTAAAGATCAAAACTTTGAGTTTATTCACAACG
GTTCAATTAAAGTTAATGAATTTCTCCAAGCACTAAATCATAAGGATGTT
TATGTCATTGGGGGTTGTGCTGCTATTTACAATGCTGCTAGTGAACAGTA
TGAAAACATCGATCTTGCTACCAATGCAGTAAAGAGTGGATTAGTAGCTG
CGATGCATATCATTGGTAGTAACCAAGTTAAACTCCAATCTATCGTTGGC
ACCAATGCACTCCATATCTTTGGTTTAAATTTAGCAGCATGTGGATTAAC
TGAACAGCGTGCTAAGAAGTTAGGTTTTGATGTTGGCATATCAGTTGTTG
ATGACAATGATCGTCCTGAGTTTATGGGCAGTTATGACAAGGTGCGTTTT
AAACTTGTATATGACAAGAAAACCCTAAGAATTTTAGGAGCACAACTCCT
TTCTTGGAATACCAATCACAGTGAGATTATTTTCTATATTGCACTTGCAA
TCCAAAAGCAGATGTTACTAACTGAACTGGGTTTAGTGGATGTTTATTTT
CTTCCACATTACAACAAACCGTTTAACTTTGTGTTAGCAACTGTTTTACA
AGCACTTGGTTTTAGCTATTACATTCCTAAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy