Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Mycoplasma genitalium Search Results

Record: 1 of 1  
MiniMap IGR199 IGR198 IGR204 IGR201 IGR202 IGR203 IGR200 apt, - MG276 pdhB, - MG273 lplA, - MG270 pdhA, - MG274 pdhC, - MG272 pdhD,dldH, - MG271 nox, - MG275 MG277 apt, - MG276 pdhB, - MG273 lplA, - MG270 pdhA, - MG274 pdhC, - MG272 pdhD,dldH, - MG271 nox, - MG275 MG277 Type: tandem, Name:  - 8 apt, - MG276 pdhB, - MG273 lplA, - MG270 pdhA, - MG274 pdhC, - MG272 pdhD,dldH, - MG271 nox, - MG275 MG277
* Calculated from Protein Sequence

Gene ID: MG274

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pdhA  

Definition:
pyruvate dehydrogenase component E1 alpha subunit

Gene Start:
333308

Gene Stop:
332235

Gene Length:
1074

Molecular Weight*:
40639

pI*:
5.57

Net Charge*:
-5.67

EC:
1.2.4.1  

Functional Class:
Energy metabolism; Pyruvate metabolism & Glycolysis  

Pathway: pathway table
Amino Acid Metabolism; Valine, leucine and isoleucine biosynthesis
Carbohydrate Metabolism; Butanoate metabolism
Carbohydrate Metabolism; Glycolysis / Gluconeogenesis
Carbohydrate Metabolism; Pyruvate metabolism

Comment:
This enzyme is designated component E1 of the pyruvate dehydrogenase complex, which
converts pyruvate to acetyl CoA and CO2. Dihydrolipoamide acetyltransferase
(MG272) is the E2 component and lipoamide dehydrogenase (MG271) is the E3
component. The beta subunit of the E1 component is encoded by MG273

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to pyruvate dehydrogenase E1 component alpha subunit
sequences, e.g. residues 1-358 are 88% similar to ODPA_MYCPN. Residues 18-357
are 42% similar to ODPA_ACHLA. MG274 is similar to CT245 and CT340, pyruvate dehydrogenase-related sequences from
C.trachomatis. It is weakly similar to CT054, a predicted alpha-ketoglutarate
dehydrogenase. No similarities are observed to T.pallidum.

COGS Summary:  COGS Search
The phylogenetic pattern of COG0567 is ehgpc-y.
COG name: Pyruvate dehydrogenase E1 alpha subunit (2-oxoglutarate dehydrogenase).
Functional Class: C
BeTs to h,g,c,y.


Blocks Summary:  Blocks Search
Residues 147-160 are matched to block PR00670C (inhibin beta A chain signature).
Residues 155-194 are weakly matched to block BL00801E (transketolase).

ProDom Summary:  Protein Domain Search
Residues 42-106, 107-134, 136-170, 171-304 constitute defined domains of ODPA_MYCGE.

Paralogs:  Local Blast Search
No paralogs in M.genitalium.

Pfam Summary:  Pfam Search
Residues 41 to 331 (E-value = 1.1e-152) place MG274 in the E1_dh family which is described as Dehydrogenase E1 component (PF00676)

PDB Hit:


Gene Protein Sequence:
MAILIKNKVPTTLYQVYDNEGKLIDPNHKITLTDEQLKHAYYLMNLSRMM
DKKMLVWQRAGKMLNFAPNLGEEALQVGMGLGLNENDWVCPTFRSGALML
YRGVKPEQLLLYWNGNEKGSQIDAKYKTLPINITIGAQYSHAAGLGYMLH
YKKQPNVAVTMIGDGGTAEGEFYEAMNIASIHKWNTVFCINNNQFAISTR
TKLESAVSDLSVKAIACGIPRVRVDGNDLIASYEAMQDAANYARGGNGPV
LIEFFSYRQGPHTTSDDPSIYRTKQEEEEGMKSDPVKRLRNFLFDRSILN
QAQEEEMFSKIEQEIQAAYEKMVLDTPVSVDEVFDYNYQELTPELVEQKQ
IAKKYFKD

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAATCTTGATTAAAAATAAAGTTCCAACTACCCTTTATCAGGTTTA
TGATAATGAGGGTAAATTAATTGATCCTAACCACAAAATTACCCTAACTG
ATGAACAGTTAAAACACGCTTATTACTTAATGAACTTGAGTAGAATGATG
GACAAAAAGATGTTAGTTTGACAGCGTGCTGGTAAGATGTTAAACTTCGC
TCCTAATTTGGGAGAGGAAGCTTTACAGGTTGGAATGGGATTAGGTTTAA
ATGAAAATGATTGGGTTTGTCCTACGTTTCGTAGTGGGGCTTTAATGTTG
TATCGTGGGGTAAAACCAGAACAACTTTTACTCTACTGAAATGGTAATGA
AAAAGGTAGTCAGATAGATGCTAAATACAAAACTTTACCTATTAACATCA
CCATTGGTGCTCAGTATTCCCATGCTGCTGGATTAGGTTACATGTTGCAC
TATAAAAAGCAACCTAATGTTGCTGTTACTATGATTGGTGATGGAGGTAC
AGCTGAAGGGGAATTTTATGAAGCGATGAACATTGCAAGCATCCACAAGT
GAAACACTGTTTTTTGTATTAACAACAATCAGTTTGCTATCTCAACAAGA
ACTAAACTTGAATCTGCTGTTAGTGATCTAAGCGTTAAAGCAATAGCATG
TGGGATCCCAAGGGTAAGGGTTGATGGTAATGATCTAATTGCTAGTTATG
AAGCGATGCAAGATGCTGCTAATTACGCTAGAGGTGGTAATGGACCAGTC
TTAATTGAGTTCTTCAGCTACCGGCAAGGTCCTCACACCACTTCAGATGA
CCCTTCTATCTACAGAACCAAACAAGAAGAGGAGGAGGGAATGAAGAGTG
ATCCAGTGAAGCGGTTGCGAAACTTCTTGTTTGATAGATCAATTCTTAAC
CAAGCTCAAGAAGAAGAGATGTTCAGCAAAATTGAACAGGAAATCCAAGC
TGCTTATGAAAAGATGGTACTAGATACTCCTGTATCAGTAGATGAGGTGT
TTGATTACAACTATCAAGAATTAACCCCTGAACTAGTTGAACAGAAACAG
ATTGCAAAAAAATACTTTAAAGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy